Overview

  • Product name

  • Description

    Rabbit polyclonal to MIST-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MIST-1 aa 120-188.
    Sequence:

    AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEA QPQGHLQRYSTQIHSFREG


    Database link: Q7RTS1

  • Positive control

    • IHC-P: Human pancreas tissue.
  • General notes

    Protein previously known as BHLHA15.

Properties

Applications

Our Abpromise guarantee covers the use of ab187978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblast populations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3'.
  • Tissue specificity

    Expressed in brain, liver, spleen and skeletal muscle.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain

    Lacks a classic transcription activation domain and instead possesses an N-terminal region capable of inhibiting heterologous activators.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basic helix loop helix domain containing class B 8 antibody
    • Basic helix loop helix family member a15 antibody
    • BHA15_HUMAN antibody
    • Bhlha15 antibody
    • bHLHB8 antibody
    • Class A basic helix-loop-helix protein 15 antibody
    • Class B basic helix-loop-helix protein 8 antibody
    • Class II bHLH protein MIST1 antibody
    • intestine and stomach expression 1 antibody
    • MIST 1 antibody
    • MIST-1 antibody
    • MIST1 antibody
    • Muscle antibody
    • Muscle intestine and stomach expression 1 antibody
    • protein MIST1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human pancreas tissue labeling MIST-1 with ab187978 at 1/200 dilution.

References

ab187978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Salivary Gland)
Permeabilization
No
Specification
Salivary Gland
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10%
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Feb 07 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up