Overview

  • Product name

    Anti-Mitofusin 2 antibody [6A8]
    See all Mitofusin 2 primary antibodies
  • Description

    Mouse monoclonal [6A8] to Mitofusin 2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-P, IP, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow, Human, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human Mitofusin 2 aa 661-757 (C terminal).
    Sequence:

    FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENL EQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR


    Database link: O95140

  • General notes

    This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab56889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration. PubMed: 22427360Fix with acetone.
WB Use at an assay dependent concentration. Predicted molecular weight: 86 kDa.
IHC-P Use at an assay dependent concentration.
IP Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PARK2 recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions.
  • Tissue specificity

    Ubiquitous; expressed at low level. Highly expressed in heart and kidney.
  • Involvement in disease

    Charcot-Marie-Tooth disease 2A2
    Neuropathy, hereditary motor and sensory, 6A
  • Sequence similarities

    Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family. Mitofusin subfamily.
    Contains 1 dynamin-type G (guanine nucleotide-binding) domain.
  • Post-translational
    modifications

    Phosphorylated by PINK1.
    Ubiquitinated by non-degradative ubiquitin by PARK2, promoting mitochondrial fusion; deubiquitination by USP30 inhibits mitochondrial fusion.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with BAX during apoptosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMT2A antibody
    • CMT2A2 antibody
    • CPRP 1 antibody
    • CPRP1 antibody
    • EC 3.6.5.- antibody
    • Fzo antibody
    • HSG antibody
    • hyperplasia suppressor gene antibody
    • Hypertension related protein 1 antibody
    • KIAA0214 antibody
    • MARF antibody
    • MFN 2 antibody
    • Mfn2 antibody
    • MFN2_HUMAN antibody
    • Mitochondrial assembly regulatory factor antibody
    • Mitofusin-2 antibody
    • Mitofusin2 antibody
    • Transmembrane GTPase MFN2 antibody
    see all

Images

  • Anti-Mitofusin 2 antibody [6A8] (ab56889) at 1 µg/ml + HeLa cell lysate at 25 µg

    Predicted band size: 86 kDa



    This image was generated using the ascites version of the product.

  • ab56889 staining mitofusin 2 in MEF1 cells treated with nigericin Na+ salt (ab120494), by ICC/IF. Decrease in mitofusin 2 expression correlates with increased concentration of nigericin Na+ salt, as described in literature.
    The cells were incubated at 37°C for 3h in media containing different concentrations of ab120494 (nigericin Na+ salt) in DMSO, fixed with 100% methanol for 5 minutes at -20°C and blocked with PBS containing 10% goat serum, 0.3 M glycine, 1% BSA and 0.1% tween for 2h at room temperature. Staining of the treated cells with ab56889 (10 µg/ml) was performed overnight at 4°C in PBS containing 1% BSA and 0.1% tween. A DyLight® 488 goat anti-mouse polyclonal antibody (ab96879) at 1/250 dilution was used as the secondary antibody. Nuclei were counterstained with DAPI and are shown in blue.

    This image was generated using the ascites version of the product.

  • Mitofusin 2 antibody (ab56889) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human kidney.

    This image was generated using the ascites version of the product.

  • Overlay histogram showing HEK293 cells stained with ab56889 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56889, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

  • ab56889 staining mitofusin2 in MEF1 cells treated with valinomycin from Streptomyces fulvissimus (ab120852), by ICC/IF. Decrease in mitofusin2 expression with increased concentration of withaferin valinomycin from Streptomyces fulvissimus, as described in literature.
    The cells were incubated at 37°C for 3h in media containing different concentrations of ab120852 (valinomycin from Streptomyces fulvissimus) in DMSO, fixed with 100% methanol for 5 minutes at -20°C and blocked with PBS containing 10% goat serum, 0.3 M glycine, 1% BSA and 0.1% tween for 2h at room temperature. Staining of the treated cells with ab56889 (10 µg/ml) was performed overnight at 4°C in PBS containing 1% BSA and 0.1% tween. A DyLight® 488 goat anti-mouse polyclonal antibody (ab96879) at 1/250 dilution was used as the secondary antibody. Nuclei were counterstained with DAPI and are shown in blue.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:

  • Ma S & Dong Z Melatonin Attenuates Cardiac Reperfusion Stress by Improving OPA1-Related Mitochondrial Fusion in a Yap-Hippo Pathway-Dependent Manner. J Cardiovasc Pharmacol 73:27-39 (2019). Read more (PubMed: 30418242) »
  • Hou X  et al. Mitofusin1 in oocyte is essential for female fertility. Redox Biol 21:101110 (2019). Read more (PubMed: 30690319) »
See all 143 Publications for this product

Customer reviews and Q&As

1-10 of 11 Q&A

Answer

Gracias por tu respuesta.

Ab50843 es una buena opción para usar con lisados de ratón mediante WB. Es un anticuerpo que se ha vendido bien, y sin embargo no tiene reclamaciones registradas.

Tiene además varios reviews de otros usuarios en WB con lisados de ratón en las que los resultados obtenidos han sido buenos (4/5 estrellas).

Si os parece, además de mandaros ab50843 gratuitamente, os puedo añadir al pedido, también de forma completamente gratuita, el anticuerpo https://www.abcam.com/mitofusin-2-antibody-niar164-ab124773.html, puesto que estos anticuerpos Rabbit Monoclonales se encuentran actualmente en promoción. Este anticuerpo también detecta Mitofusin 2 en lisados de ratón mediante WB.

Si me confirmas que estáis de acuerdo con recibir ambas unidades, realizaré el pedido inmediatamente.

Espero tu respuesta para saber cómo proceder. Que pases una buena tarde.

Read More

Answer

Te agradezco mucho las molestias tomadas para enviarnos el cuestionario con la imagen adjunta.

Revisando el protocolo me temo que no tengo muchas sugerencias que añadir, puesto que se ha usado el anticuerpo de acuerdo a un protocolo estándar, y similar al que utilizamos en nuestro laboratorio. Entendemos que siguiendo este protocolo debería haberse encontrado una banda al pero molecular estimado.

Solo puedo sugeriros, en caso de que queráis darle otra oportunidad al anticuerpo, que se utilicen condiciones no reductoras del gel, tal y como indica el Abreview enviado por otro usuario del anticuerpo:

https://www.abcam.com/index.html?datasheet=56889&tab=abreviews&intabreviewid=23329

Si tenéis acceso a lisados donde la proteína se exprese con intensidad (http://www.proteinatlas.org/ENSG00000116688), podéis utilizarlo como control positivo adicional.

Entiendo que el secundario está en perfectas condiciones porque se ha empleado con otros primarios.

Siendo que el anticuerpo se adquirió recientemente, la garantía lo cubre, y si preferís puedo enviaros un reemplazo del anticuerpo (aunque me temo que el único lote actualmente en stock es el mismo que ya habéis usado), o de otro anticuerpo del catálogo (https://www.abcam.com/Search?Keywords=Mitofusin+2+&fReset=1&pt=1&source=TopSearch&btnSearch=Search#Search?AppliedFacets.FacetProductType=Primary+antibodies&AppliedFacets.FacetTargetName=Mitofusin+2&AppliedFacets.FacetApplication=WB&IsFacetsOnly=False&PageNu).

Sino, un reembolso o vale sin caducidad también podría emitirse.

Además, aprovecho la ocasión para comentaros que actualmente tenemos una promoción por la que al hacer el envío de cualquier anticuerpo primario (aunque sea un envío gratuito) os regalamos otro primario Rabbit Monoclonal. Para más información picha https://www.abcam.com/index.html?pageconfig=resource&rid=15447.

Espero tu respuesta para que me indiques como proceder.

Read More

Answer

Thank you for your reply.

As requested, I am sending you the 2 antibodies a free of charge replacements. One of the replacements is out of stock, but we should have it back in by July2nd (one week from now) and then we will get it to you as soon as possible. Hopefully you should have it by early next week, I am sorry about the delay. Your new order number is *.

If there is anything else I can help you with, please let me know.

Read More

Answer

Thank you for your reply.

For Mitofusin 2, I would recommend ab124773 as a replacement:

https://www.abcam.com/Mitofusin-2-antibody-NIAR164-ab124773.html





For Mitofusin 1, I would recommend ab57602 as a replacement:

https://www.abcam.com/Mitofusin-1-antibody-ab57602.html



If these antibodies would be suitable replacements for you, then please let me know and I will be happy to have then sent out to you. If you would rather have a refund, we can do that aswell.

I look forward to your reply and resolving this situation for you.

Read More

Answer

Thank you for your reply.

I am sorry that the protocol variations did not prove to be successful for. If you could please send me send me either the Abcam order number or the PO# that was used to purchase the antibodies, then I would be happy to replace them with antibodies of your choice.

I look forward to your reply.

Read More

Question
Answer

Thank you for contacting Abcam earlier today.

I am sorry that you are having some issues with our antibodies in either IF or IHC staining. Please find attached the protocols booklet that we talked about. Also, if you could send me a copy of the protocol that you are using then I would be happy to look it over and see if there is anything that I can suggest that will help resolve the issue.

I look forward to your reply.

Read More

Answer


I am very pleased to hear you would like to accept our offer and test ab56889 in Drosophila. This code will give you: 1 freeprimary antibodybefore the expiration date. To redeem this offer, please submit an Abreview forDrosophila and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Please remember that submission of the Abreview is sufficient for the discount code to become active.
For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.


Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Answer

Thank you very much for your interest in ab56889.

To our knowledge, ab56889 has not been tested in Drosophila. Therefore, I can offer a discount off a future purchase if you buy ab56889 now, test it in Drosophila and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of: 1 free primary antibody. If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab56889 in Drosophila. I will then send a discount code. This code must be issued before purchasing ab56889 so please wait for my reply before ordering.

2. Purchase ab56889 either by phone, fax, or online (www.abcam.com).

3. Test it in Drosophila.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibodyordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab56889 turns out to be unsuitable for Drosophila you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Question
Answer

Thank you for your call today and for letting us know about the trouble with this antibody. Please keep me updated about any new results after using some of the protocol alterations that we discussed. If you have any questions or if there is anything else that we can do for you, please let me know. I look forward to hearing from you.

Read More

Answer

Thank you for contacting us. My colleague "Ariana" has already sent her reply so I am closing this case. The antibodies are fine for 1 week at room temperature however in your case if the products fail to perform I would suggest getting refund from insurance company. You can get information of product price from our website at  https://www.abcam.com/ I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.    

Read More

1-10 of 11 Q&A

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up