Overview

  • Product name

  • Description

    Rabbit polyclonal to Mitofusin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human Mitofusin 2 aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYI


    Database link: O95140

  • Positive control

    • Human kidney and breast cancer tissues; mouse kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

If using a fluorescent secondary antibody the recommended dilution is 1/50 - 1/200.

Target

  • Function

    Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PARK2 recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions.
  • Tissue specificity

    Ubiquitous; expressed at low level. Highly expressed in heart and kidney.
  • Involvement in disease

    Charcot-Marie-Tooth disease 2A2
    Neuropathy, hereditary motor and sensory, 6A
  • Sequence similarities

    Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family. Mitofusin subfamily.
    Contains 1 dynamin-type G (guanine nucleotide-binding) domain.
  • Post-translational
    modifications

    Phosphorylated by PINK1.
    Ubiquitinated by non-degradative ubiquitin by PARK2, promoting mitochondrial fusion; deubiquitination by USP30 inhibits mitochondrial fusion.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with BAX during apoptosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMT2A antibody
    • CMT2A2 antibody
    • CPRP 1 antibody
    • CPRP1 antibody
    • EC 3.6.5.- antibody
    • Fzo antibody
    • HSG antibody
    • hyperplasia suppressor gene antibody
    • Hypertension related protein 1 antibody
    • KIAA0214 antibody
    • MARF antibody
    • MFN 2 antibody
    • Mfn2 antibody
    • MFN2_HUMAN antibody
    • Mitochondrial assembly regulatory factor antibody
    • Mitofusin-2 antibody
    • Mitofusin2 antibody
    • Transmembrane GTPase MFN2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling Mitofusin 2 with ab218162 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse kidney tissue labeling Mitofusin 2 with ab218162 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling Mitofusin 2 with ab218162 at 1/200 dilution, followed by Goat Anti-Rabbit IgG, FITC conjugated at 1/200 dilution for 40 minutes at 37°C.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast cancer tissue labeling Mitofusin 2 with ab218162 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up