Overview

  • Product name

  • Description

    Rabbit polyclonal to MitoNEET
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human MitoNEET aa 54-103 (C terminal).
    Sequence:

    PKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLII


    Database link: NP_060934

  • Positive control

    • HepG2 cell lysate
  • General notes

    Previously labelled as CISD1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab133970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12 kDa.

Target

  • Function

    Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation (By similarity). May be involved in Fe-S cluster shuttling and/or in redox reactions.
  • Tissue specificity

    Expression is reduced in cells derived from cystic fibrosis patients.
  • Sequence similarities

    Belongs to the CISD protein family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AU043990 antibody
    • AW743335 antibody
    • C10orf70 antibody
    • CDGSH iron sulfur domain 1 antibody
    • CDGSH iron-sulfur domain-containing protein 1 antibody
    • CISD 1 antibody
    • CISD1 antibody
    • CISD1_HUMAN antibody
    • D10Ertd214e antibody
    • MDS029 antibody
    • MGC14684 antibody
    • MitoNEET antibody
    • RGD1309529 antibody
    • ZCD1 antibody
    • Zinc finger CDGSH type domain 1 antibody
    see all

Images

  • Anti-MitoNEET antibody (ab133970) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size: 12 kDa

References

ab133970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up