Overview

  • Product name

    Anti-Mkl1/MRTFA antibody [CL4281]
    See all Mkl1/MRTFA primary antibodies
  • Description

    Mouse monoclonal [CL4281] to Mkl1/MRTFA
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Mkl1/MRTFA aa 556-680.
    Sequence:

    EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPA TNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAP PTLITDSTGTHLVLTVTNKNADSPG


    Database link: Q969V6

  • Epitope

    Binds to an epitope located within the peptide sequence PTLITDSTGTHLVLT as determined by overlapping synthetic peptides.
  • Positive control

    • Human lymph node tissue, Human testis tissue; HL60 cell lysate
  • General notes

     This product was previously labelled as Mkl1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab219981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 99 kDa.

Target

  • Function

    Transcriptional coactivator of serum response factor (SRF) with the potential to modulate SRF target genes. Suppresses TNF-induced cell death by inhibiting activation of caspases; its transcriptional activity is indispensable for the antiapoptotic function. It may up-regulate antiapoptotic molecules, which in turn inhibit caspase activation.
  • Tissue specificity

    Ubiquitously expressed, has been detected in lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, muscle, heart and brain.
  • Involvement in disease

    Note=A chromosomal aberration involving MKL1 may be a cause of acute megakaryoblastic leukemia. Translocation t(1;22)(p13;q13) with RBM15. Although both reciprocal fusion transcripts are detected in acute megakaryoblastic leukemia (AMKL, FAB-M7), the RBM15-MKL1 chimeric protein has all the putative functional domains encoded by each gene and is the candidate oncogene.
  • Sequence similarities

    Contains 2 RPEL repeats.
    Contains 1 SAP domain.
  • Domain

    The N-terminal region is required for nuclear localization and the C-terminal region mediates transcriptional activity.
    The RPEL repeats mediate binding to globular actin.
  • Cellular localization

    Cytoplasm. Nucleus. Binding to globular actin is required to maintain cytoplasmic localization.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI852829 antibody
    • AMKL antibody
    • AW743281 antibody
    • AW821984 antibody
    • Basic SAP coiled-coil transcription activator antibody
    • Bsac antibody
    • KIAA1438 antibody
    • Mal antibody
    • Megakaryoblastic leukemia 1 protein antibody
    • Megakaryocytic acute leukemia protein antibody
    • MKL (megakaryoblastic leukemia)/myocardin like 1 antibody
    • MKL/myocardin like protein 1 antibody
    • MKL/myocardin-like protein 1 antibody
    • Mkl1 antibody
    • MKL1_HUMAN antibody
    • MRTF A antibody
    • Mrtf A antibody
    • MRTF-A antibody
    • MRTFA antibody
    • MYOCARDIN RELATED PROTEIN antibody
    • Myocardin related transcription factor A antibody
    • Myocardin-related transcription factor A antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human lymph node tissue labeling Mkl1/MRTFA with ab219981 at 1/50 dilution. 

  • Immunohistochemical analysis of paraffin embedded Human testis tissue labeling Mkl1/MRTFA with ab219981 at 1/50 dilution. 

  • Anti-Mkl1/MRTFA antibody [CL4281] (ab219981) at 1/500 dilution + HL60 cell lysate

    Predicted band size: 99 kDa

References

ab219981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up