Overview

  • Product name

  • Description

    Rabbit polyclonal to MKLP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MKLP1 aa 865-960.
    Sequence:

    LASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTV APAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP


    Database link: Q02241

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.

Target

  • Function

    Plus-end-directed motor enzyme that moves antiparallel microtubules in vitro. Localizes to the interzone of mitotic spindles.
  • Sequence similarities

    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • CHO 1 antibody
    • CHO1 antibody
    • KIF 23 antibody
    • KIF23 antibody
    • KIF23_HUMAN antibody
    • Kinesin family member 23 antibody
    • Kinesin like 5 antibody
    • Kinesin like protein 5 antibody
    • Kinesin like protein KIF 23 antibody
    • Kinesin like protein KIF23 antibody
    • Kinesin-like protein 5 antibody
    • Kinesin-like protein KIF23 antibody
    • KNS L5 antibody
    • KNSL 5 antibody
    • KNSL5 antibody
    • Mitotic kinesin like 1 antibody
    • Mitotic kinesin like protein 1 antibody
    • Mitotic kinesin-like protein 1 antibody
    • MKLP 1 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for MKLP1 using ab235955 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up