Overview

  • Product name

    Anti-MKP-1 antibody [OTI4F10]
    See all MKP-1 primary antibodies
  • Description

    Mouse monoclonal [OTI4F10] to MKP-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human MKP-1 aa 1-367. Produced in E.coli (NP_004408).
    Sequence:

    MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFST IVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDG TLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLS TSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGI TALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNA GGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHST NSALSYLQSPITTSPSC


    Database link: P28562

  • Positive control

    • WB: pCMV6-ENTRY MKP-1 cDNA transfected HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 39 kDa.

Target

  • Function

    Dual specificity phosphatase that dephosphorylates MAP kinase ERK2 on both 'Thr-183' and 'Tyr-185'.
  • Tissue specificity

    Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • CL 100 antibody
    • CL100 antibody
    • Dual Specificity Phosphatase 1 antibody
    • Dual specificity protein phosphatase 1 antibody
    • Dual specificity protein phosphatase hVH1 antibody
    • DUS1_HUMAN antibody
    • DUSP 1 antibody
    • Dusp1 antibody
    • HVH1 antibody
    • MAP kinase phosphatase 1 antibody
    • Mitogen-activated protein kinase phosphatase 1 antibody
    • MKP-1 antibody
    • MKP1 antibody
    • Protein tyrosine phosphatase CL100 antibody
    • Protein-tyrosine phosphatase CL100 antibody
    • PTPN10 antibody
    • Serine/threonine specific protein phosphatase antibody
    • VH1 antibody
    see all

Images

  • All lanes : Anti-MKP-1 antibody [OTI4F10] (ab236501) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY DUSP1 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 39 kDa

References

ab236501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up