Overview

  • Product name
  • Description
    Rabbit polyclonal to MKS1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MKS1 aa 6-162. BC010061
    Sequence:

    WSTDTGEAVYRSRDPVRNLRLRVHLQRITSSNFLHYQPAAELGKDLIDLA TFRPQPTASGHRPEEDEEEEIVIGWQEKLFSQFEVDLYQNETACQSPLDY QYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFL VERMANV


    Database link: Q9NXB0

  • Positive control
    • HepG2 cell lysate, Human fetal colon tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 65 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Involved in centrosome migration to the apical cell surface during early ciliogenesis. Required for ciliary structure and function, including a role in regulating length and appropriate number through modulating centrosome duplication. Required for cell branching morphology.
  • Involvement in disease
    Meckel syndrome 1
    Bardet-Biedl syndrome 13
  • Sequence similarities
    Contains 1 B9 domain.
  • Cellular localization
    Cytoplasm > cytoskeleton > cilium basal body. Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Localizes at the transition zone, a region between the basal body and the ciliary axoneme.
  • Information by UniProt
  • Database links
  • Alternative names
    • B8d3 antibody
    • BBS13 antibody
    • Dysencephalia splanchnocystica antibody
    • FABB proteome like protein antibody
    • FLJ20345 antibody
    • Gruber syndrome antibody
    • Meckel gruber syndrome antibody
    • Meckel gruber syndrome type 1 antibody
    • Meckel syndrome antibody
    • Meckel syndrome type 1 antibody
    • Meckel syndrome type 1 protein antibody
    • Meckel syndrome type 1 protein homolog antibody
    • MES antibody
    • MKS 1 antibody
    • MKS antibody
    • Mks1 antibody
    • MKS1_HUMAN antibody
    • POC12 antibody
    • POC12 centriolar protein homolog antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal colon tissue labeling MKS1 with ab177207 at 1/100 dilution.

  • Anti-MKS1 antibody (ab177207) at 1/1000 dilution + HepG2 cell lysate

    Predicted band size: 65 kDa

References

ab177207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up