Overview

  • Product name

    Anti-MKX antibody [OTI6A12]
    See all MKX primary antibodies
  • Description

    Mouse monoclonal [OTI6A12] to MKX
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human MKX aa 1-352. Produced in E.coli (NP_775847).
    Sequence:

    MNTIVFNKLSGAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPP LKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDNPYPTK TEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWALRIKLYNKYV QGNAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSENSVIKA GVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNH SGSFSSNEFEEELVSPSSSETEGNFVYRTDTLENGSNKGESAANRKGPSK DDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQ QF


    Database link: Q8IYA7

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY MKX cDNA for 48 hrs. IHC-P: Human prostate and prostate carcinoma tissues.
  • General notes

    Clone OTI6A12 (formerly 6A12).

Properties

Applications

Our Abpromise guarantee covers the use of ab236400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris, pH 8.5, 120°C for 3 minutes.

WB 1/2000. Predicted molecular weight: 39 kDa.

Target

  • Function

    May act as a morphogenetic regulator of cell adhesion.
  • Sequence similarities

    Belongs to the TALE/IRO homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9430023B20Rik antibody
    • C10orf48 antibody
    • Homeobox protein Mohawk antibody
    • IFRX antibody
    • Iroquois family related homeodomain protein antibody
    • iroquois homeobox protein like 1 antibody
    • IRXL1 antibody
    • MGC39616 antibody
    • MKX antibody
    • MKX_HUMAN antibody
    • mohawk homeobox antibody
    • OTTHUMP00000019374 antibody
    see all

Images

  • All lanes : Anti-MKX antibody [OTI6A12] (ab236400) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hrs.
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY MKX cDNA for 48 hrs.

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 39 kDa

  • Paraffin-embedded human prostate tissue stained for MKX using ab236400 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for MKX using ab236400 at 1/150 dilution in immunohistochemical analysis.

References

ab236400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up