Overview

  • Product name

  • Description

    Rabbit polyclonal to MLC1SA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human MLC1SA aa 5-199. (Expressed in E.coli).
    Sequence:

    KDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDL SKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAE VLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFD KEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYE


    Database link: P14649

  • Positive control

    • IHC-P: Human kidney tissue. WB: Rat skeletal muscle lysate; Recombinant human MLC1SA protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231271 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function

    Regulatory light chain of myosin. Does not bind calcium.
  • Sequence similarities

    Contains 3 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • MLC1sa antibody
    • MYL 6B antibody
    • Myl6b antibody
    • MYL6B_HUMAN antibody
    • Myosin alkali light chain 1 slow a antibody
    • Myosin light chain 1 slow a antibody
    • Myosin light chain 1 slow twitch muscle A isoform antibody
    • Myosin light chain 1 slow-twitch muscle A isoform antibody
    • Myosin light chain 6B alkali smooth muscle and non muscle antibody
    • Myosin light chain 6B antibody
    • Myosin light polypeptide 6B alkali smooth muscle and non muscle antibody
    • Myosin light polypeptide 6B antibody
    • Smooth muscle and non muscle myosin alkali light chain 6B antibody
    • Smooth muscle and nonmuscle myosin light chain alkali 6B antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for MLC1SA using ab231271 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-MLC1SA antibody (ab231271) at 2 µg/ml + Recombinant human MLC1SA protein.

    Predicted band size: 23 kDa

  • Anti-MLC1SA antibody (ab231271) at 2 µg/ml + Rat skeletal muscle lysate.

    Predicted band size: 23 kDa

References

ab231271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up