Overview

  • Product name

  • Description

    Rabbit polyclonal to MLD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human MLD aa 1-50 (N terminal).
    Sequence:

    MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMM


    Database link: NP_003667

  • Positive control

    • Skeletal Muscle (Human) Membrane Lysate - fetal normal tissue (ab29321) can be used as a positive control in WB. Fetal muscle lysate
  • General notes

     This product was previously labelled as DEGS1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab80654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. It contains three His containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It has sphingolipid-delta-4-desaturase activity and converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine).
  • Cellular localization

    Endoplasmic reticulum and Mitochondrial
  • Database links

  • Alternative names

    • Degenerative spermatocyte homolog 1 antibody
    • Degenerative spermatocyte homolog 1 lipid desaturase antibody
    • Degenerative spermatocyte homolog lipid desaturase antibody
    • DEGS 1 antibody
    • DEGS antibody
    • Delta 4 desaturase sphingolipid 1 antibody
    • Des 1 antibody
    • DES1 antibody
    • Dihydroceramide desaturase antibody
    • FADS7 antibody
    • Membrane fatty acid (lipid) desaturase antibody
    • Membrane lipid desaturase antibody
    • MGC5079 antibody
    • MIG15 antibody
    • Migration inducing gene 15 protein antibody
    • MLD antibody
    • Sphingolipid delta 4 desaturase antibody
    • Sphingolipid delta(4) desaturase DES1 antibody
    see all

Images

  • Anti-MLD antibody (ab80654) at 1 µg/ml + fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa
    Observed band size: 38 kDa



    Gel concentration 12%

References

ab80654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Macrophage cells)
Loading amount
50 µg
Specification
Macrophage cells
Gel Running Conditions
Non-reduced Denaturing (10% precast polyacrylamide gel)
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jun 12 2012

Answer

I'm happy to help! Best of luck in your experiments!

Read More

Answer



***Regarding your question, I recommend diluting the antibody in TBST + 1% BSA for incubation with the membrane***

I am very pleased to hear you would like to accept our offer and test ab80654 in mouse. This code will give you 1 freeprimary antibodybefore the expiration date. To redeem this offer, please submit an Abreview formouse and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Please remember that submission of the Abreview is sufficient for the discount code to become active.

For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Answer

Thank you very much for your interest in ab80654.

To our knowledge, ab80654 has not been tested in mouse. Therefore, I can offer a discount off a future purchase if you buy ab80654 now, test it inmouse and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab80654 in mouse.I will then send a discount code. This code must be issued before purchasing ab80654 so please wait for my reply before ordering.

2. Purchase ab80654 either by phone, fax, or online (www.abcam.com).

3. Test it in mouse.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibodyordered and the discount code is valid for 4 months after issue.

Please remember that submission of the Abreview is sufficient for the discount code to become active.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab80654 turns out to be unsuitable formouse, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up