Overview

  • Product name

    Anti-MLL5 antibody
  • Description

    Rabbit polyclonal to MLL5
  • Host species

    Rabbit
  • Specificity

    This antibody detects endogenous levels of MLL5 protein.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MLL5 aa 1-1858.
    Sequence:

    MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSS HHSHSYIGLPYADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDET SSATTISTSEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGID RQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGDTSATESGDEVPV ELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISKCKKAFREGSR KSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLP PDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTF GNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDY GNCKYKVDCACLKENPECPVLKRSSESMENINSGYETRRKKGKKDKDISK EKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNNQEPDFIDDIE EKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQ RKSFSRSRTHIGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTI EPETETALAEIITETEVPALNKCPTKYPKTKKHLVNEWLSEKNEKTGKPS DGLSERPLRITTDPEVLATQLNSLPGLTYSPHVYSTPKHYIRFTSPFLSE KRRRKEPTENISGSCKKRWLKQALEEENSAILHRFNSPCQERSRSPAVNG ENKSPLLLNDSCSLPDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH TDITPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFEN ISSPESSPEIKRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGY TSPRSRTEVNRQCPGEKEPVSDLQLGLDAVEPTALHKTLETPAHDRAEPN SQLDSTHSGRGTMYSSWVKSPDRTGVNFSVNSNLRDLTPSHQLEVGGGFR ISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDNLIDGNCTPQN PPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSNNGDGCA SSNDNGEQVDHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEV QWTASTSVEQVRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPS SHSNHIPQLQAKGPVPSFSELMEDPDPENPEPTTTNECPSPDTSQNTCKS PPKMSKPGSPGSVIPAQAHGKIFTKPDPQWDSTVSASEAENGVHLKTELQ QKQLSNNNQALSKNHPPQTHVRNSSEQLSQKLPSVPTKLHCPPSPHLENP PKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY PAAQNLPANTQQATSGTLFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPP PPSSSYYQNQQPSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVP GHHVTPGHFLPSQNPTIHHQTAAAVVPPPPPPPPAPGPHLVQQPNSHQQH SVAHVVGPVHAVTPGSHIHSQTAGHHLPPPPPPPGPAPHHHPPPHPSTGL QGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQALHHPPHQGPPLF PSSAHPTVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGP NSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQN NYHGSGWH


    Database link: Q8IZD2

Properties

Applications

Our Abpromise guarantee covers the use of ab192582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 205 kDa.

Target

  • Function

    Histone methyltransferase that specifically mono- and dimethylates 'Lys-4' of histone H3 (H3K4me1 and H3K4me2). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Key regulator of hematopoiesis involved in terminal myeloid differentiation and in the regulation of hematopoietic stem cell (HSCs) self-renewal by a mechanism that involves DNA methylation. Plays an essential role in retinoic-acid-induced granulopoiesis by acting as a coactivator of RAR-alpha (RARA) in target gene promoters. Also acts as an important cell cycle regulator, participating in cell cycle regulatory network machinery at multiple cell cycle stages. Required to suppress inappropriate expression of S-phase-promoting genes and maintain expression of determination genes in quiescent cells. Overexpression inhibits cell cycle progression, while knockdown induces cell cycle arrest at both the G1 and G2/M phases.
  • Tissue specificity

    Widely expressed in both adult and fetal tissues. Highest levels of expression observed in fetal thymus and kidney and in adult hematopoietic tissues, jejunum and cerebellum.
  • Sequence similarities

    Belongs to the histone-lysine methyltransferase family. TRX/MLL subfamily.
    Contains 1 PHD-type zinc finger.
    Contains 1 SET domain.
  • Post-translational
    modifications

    O-glycosylation at Thr-440 in the SET domain by OGT is essential for the histone methyltransferase and the coactivator activity toward RARA in granulopoiesis. The absence of Thr-440 glycosylation in assays done in vitro may explain why some authors did not detected any histone methyltransferase activity for this protein.
  • Cellular localization

    Nucleus speckle. Absent from the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HDCMC04P antibody
    • Histone lysine N methyltransferase MLL5 antibody
    • Histone-lysine N-methyltransferase MLL5 antibody
    • KMT2E antibody
    • Lysine N methyltransferase 2E antibody
    • Lysine N-methyltransferase 2E antibody
    • MGC70452 antibody
    • Mll5 antibody
    • MLL5_HUMAN antibody
    • Myeloid/lymphoid or mixed lineage leukemia 5 (trithorax homolog, Drosophila) antibody
    • Myeloid/lymphoid or mixed lineage leukemia 5 antibody
    • Myeloid/lymphoid or mixed lineage leukemia protein 5 antibody
    • Myeloid/lymphoid or mixed-lineage leukemia protein 5 antibody
    see all

References

ab192582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Colon)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate
Permeabilization
No
Specification
Colon
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Sep 29 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up