Anti-MLX-interacting protein antibody (ab176688)
Key features and details
- Rabbit polyclonal to MLX-interacting protein
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MLX-interacting protein antibody
See all MLX-interacting protein primary antibodies -
Description
Rabbit polyclonal to MLX-interacting protein -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human MLX-interacting protein aa 869-919. The exact sequence is proprietary. NP_055753.3.
Sequence:DQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIGKRLGE S
Database link: Q9HAP2 -
Positive control
- HeLa, Jurkat or 293T lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176688 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP |
Use at 2-10 µg/mg of lysate.
|
|
WB |
1/2000 - 1/10000. Predicted molecular weight: 101 kDa.
|
Notes |
---|
IP
Use at 2-10 µg/mg of lysate. |
WB
1/2000 - 1/10000. Predicted molecular weight: 101 kDa. |
Target
-
Relevance
MLX-interacting protein is a basic helix-loop-helix leucine zipper transcription factor of the Myc/Max/Mad superfamily. This protein binds to DNA as a heterdimer with MLX, resulting in transcription activation. MLX-interacting protein plays a role in transcriptional activation of glycolytic target genes and is involved in glucose-responsive gene regulation. -
Cellular localization
Cytoplasmic, Mitochondrial uter membrane and Nuclear. Note: Predominantly cytoplasmic but shuttles between cytoplasm and nucleus when associated with MLX. Also associates with the outer mitochondrial membrane and may shuttle between the outer mitochondrial membrane and the nucleus. -
Database links
- Entrez Gene: 452323 Chimpanzee
- Entrez Gene: 101129011 Gorilla
- Entrez Gene: 22877 Human
- Entrez Gene: 100439640 Orangutan
- Omim: 608090 Human
- SwissProt: Q9HAP2 Human
-
Alternative names
- BHLHE36 antibody
- Class E basic helix loop helix protein 36 antibody
- MIR antibody
see all
Images
-
All lanes : Anti-MLX-interacting protein antibody (ab176688) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : Jurkat lysate at 50 µg
Lane 4 : 293T lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 101 kDa
Exposure time: 30 seconds -
Detection of Human MLX-interacting protein by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176688 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated MLX-interacting protein, ab176688 was used at 0.4 µg/ml.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab176688 has not yet been referenced specifically in any publications.