Anti-MLX-interacting protein antibody (ab176688)

Submit a review Submit a question
Western blot - Anti-MLX-interacting protein antibody (ab176688)
  • Immunoprecipitation - Anti-MLX-interacting protein antibody (ab176688)

Key features and details

  • Rabbit polyclonal to MLX-interacting protein
  • Suitable for: IP, WB
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-MLX-interacting protein antibody
    See all MLX-interacting protein primary antibodies

  • Description

    Rabbit polyclonal to MLX-interacting protein

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IP, WBmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan

  • Immunogen

    Synthetic peptide within Human MLX-interacting protein aa 869-919. The exact sequence is proprietary. NP_055753.3.
    Sequence:

    DQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIGKRLGE S


    Database link: Q9HAP2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • HeLa, Jurkat or 293T lysate.

  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab176688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP
Use at 2-10 µg/mg of lysate.
WB
1/2000 - 1/10000. Predicted molecular weight: 101 kDa.
Notes
IP
Use at 2-10 µg/mg of lysate.
WB
1/2000 - 1/10000. Predicted molecular weight: 101 kDa.

Target

  • Relevance

    MLX-interacting protein is a basic helix-loop-helix leucine zipper transcription factor of the Myc/Max/Mad superfamily. This protein binds to DNA as a heterdimer with MLX, resulting in transcription activation. MLX-interacting protein plays a role in transcriptional activation of glycolytic target genes and is involved in glucose-responsive gene regulation.

  • Cellular localization

    Cytoplasmic, Mitochondrial uter membrane and Nuclear. Note: Predominantly cytoplasmic but shuttles between cytoplasm and nucleus when associated with MLX. Also associates with the outer mitochondrial membrane and may shuttle between the outer mitochondrial membrane and the nucleus.

  • Database links

    • Alternative names

      • BHLHE36 antibody
      • Class E basic helix loop helix protein 36 antibody
      • MIR antibody
      • MLXIP antibody
      • MONDOA antibody
      • Transcriptional activator MondoA antibody
      see all

    Images

    • Western blot - Anti-MLX-interacting protein antibody (ab176688)
      Western blot - Anti-MLX-interacting protein antibody (ab176688)
      All lanes : Anti-MLX-interacting protein antibody (ab176688) at 0.04 µg/ml

      Lane 1 : HeLa lysate at 50 µg
      Lane 2 : HeLa lysate at 15 µg
      Lane 3 : Jurkat lysate at 50 µg
      Lane 4 : 293T lysate at 50 µg

      Developed using the ECL technique.

      Predicted band size: 101 kDa


      Exposure time: 30 seconds
    • Immunoprecipitation - Anti-MLX-interacting protein antibody (ab176688)
      Immunoprecipitation - Anti-MLX-interacting protein antibody (ab176688)

      Detection of Human MLX-interacting protein by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176688 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated MLX-interacting protein, ab176688 was used at 0.4 µg/ml.

    References (0)

    Publishing research using ab176688? Please let us know so that we can cite the reference in this datasheet.

    ab176688 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab176688.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com