Overview

  • Product name

  • Description

    Rabbit polyclonal to MMAB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MMAB aa 169-250.
    Sequence:

    AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSD YLFTLARYAAMKEGNQEKIYMKNDPSAESEGL


    Database link: Q96EY8

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: A431 cells. WB: RT4 and U-251 MG cell lysate; Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab243596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Tissue specificity

    Expressed in liver and skeletal muscle.
  • Pathway

    Cofactor biosynthesis; adenosylcobalamin biosynthesis; adenosylcobalamin from cob(II)yrinate a,c-diamide: step 2/7.
  • Involvement in disease

    Defects in MMAB are the cause of methylmalonic aciduria type cblB (MMAB) [MIM:251110]; also known as methylmalonic aciduria type B or vitamin B12-responsive methylmalonicaciduria of cblB complementation type. MMAB is a disorder of methylmalonate and cobalamin metabolism due to defective synthesis of adenosylcobalamin. Inheritance is autosomal recessive.
  • Sequence similarities

    Belongs to the Cob(I)alamin adenosyltransferase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • aquocob(I)alamin vitamin B12s adenosyltransferase antibody
    • ATP:cob(I)alamin adenosyltransferase antibody
    • ATP:corrinoid adenosyltransferase antibody
    • ATR antibody
    • c-diamide adenosyltransferase antibody
    • cblB antibody
    • Cob antibody
    • Cob(I)alamin adenosyltransferase antibody
    • Cob(I)yrinic acid a antibody
    • cob(I)yrinic acid a c diamide adenosyltransferase mitochondrial antibody
    • Methylmalonic aciduria (cobalamin deficiency) cblB type antibody
    • Methylmalonic aciduria type B protein antibody
    • MGC20496 antibody
    • mitochondrial antibody
    • MMAB antibody
    • MMAB gene antibody
    • MMAB_HUMAN antibody
    • OTTHUMP00000240563 antibody
    • OTTHUMP00000240564 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for MMAB using ab243596 at 1/500 dilution in immunohistochemical analysis.

  • Paraformaldehyde-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells labeling MMAB (Green) using ab243596 at 4 µg/mL in ICC/IF analysis.

  • All lanes : Anti-MMAB antibody (ab243596) at 0.4 µg/ml

    Lane 1 : RT (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) whole cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate

References

ab243596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up