Overview

  • Product name

    Anti-MMADHC antibody
  • Description

    Rabbit polyclonal to MMADHC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MMADHC aa 98-193.
    Sequence:

    TLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETYFESARVE CAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEV


    Database link: Q9H3L0

  • Positive control

    • Human liver, testis and prostate tissue
  • General notes

     This product was previously labelled as C2ORF25

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in cobalamin metabolism.
  • Tissue specificity

    Widely expressed at high levels.
  • Involvement in disease

    Defects in MMADHC are the cause of methylmalonic aciduria and homocystinuria type cblD (MMAHCD) [MIM:277410]. A disorder of cobalamin metabolism characterized by decreased levels of the coenzymes adenosylcobalamin (AdoCbl) and methylcobalamin (MeCbl). Clinical features include developmental delay, hyotonia, mental retardation, seizures, megaloblastic anemia. Some patients manifest combined methylmalonic aciduria and homocystinuria (referred to as cblD original), some have only isolated homocystinuria (cblD variant 1), and others have only methylmalonic aciduria (cblD variant 2).
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • C2orf25 antibody
    • cblD antibody
    • Chromosome 2 open reading frame 25 antibody
    • CL25022 antibody
    • Methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria antibody
    • Methylmalonic aciduria and homocystinuria type D protein antibody
    • methylmalonic aciduria and homocystinuria type D protein, mitochondrial antibody
    • mitochondrial antibody
    • MMAD_HUMAN antibody
    • Mmadhc antibody
    • Protein C2orf25, mitochondrial antibody
    see all

Images

  • Immunohistochemical analysis of human placenta tissue labeling MMADHC with ab204313 at 1/200 dilution.

  • Anti-MMADHC antibody (ab204313) at 0.4 µg/ml + K562 cells
  • Immunohistochemical analysis of human liver tissue labeling MMADHC with ab204313 at 1/200 dilution.

  • Immunohistochemical analysis of human testis tissue labeling MMADHC with ab204313 at 1/200 dilution.

  • Immunohistochemical analysis of human prostate tissue labeling MMADHC with ab204313 at 1/200 dilution.

References

ab204313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (pancreas, skin)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA pH 9
Permeabilization
No
Specification
pancreas, skin
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 15% · Temperature: 20°C
Fixative
10% NBF

Abcam user community

Verified customer

Submitted Nov 09 2016

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (pancreas, skin)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA pH 9
Permeabilization
No
Specification
pancreas, skin
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 15% · Temperature: 20°C
Fixative
10% NBF

Abcam user community

Verified customer

Submitted Nov 09 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up