Anti-MMP11 antibody [OTI3E10] (ab236510)
Key features and details
- Mouse monoclonal [OTI3E10] to MMP11
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-MMP11 antibody [OTI3E10]
See all MMP11 primary antibodies -
Description
Mouse monoclonal [OTI3E10] to MMP11 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MMP11 aa 239-488. (NP_005931) produced in E.coli
Sequence:FRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPD APPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQG LPSPVDAAFEDAQGHIWFFQGAQYWVYDGEKPVLGPAPLTELGLVRFPVH AALVWGPEKNKIYFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDA AFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL
Database link: P24347 -
Positive control
- WB: HEK-293T transfected with pCMV6-ENTRY MMP11; MDA-MB-231 and T-47D whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI3E10 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236510 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500. Predicted molecular weight: 55 kDa. |
Target
-
Function
May play an important role in the progression of epithelial malignancies. -
Tissue specificity
Specifically expressed in stromal cells of breast carcinomas. -
Sequence similarities
Belongs to the peptidase M10A family.
Contains 4 hemopexin-like domains. -
Domain
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Post-translational
modificationsThe precursor is cleaved by a furin endopeptidase. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 4320 Human
- Omim: 185261 Human
- SwissProt: P24347 Human
- Unigene: 143751 Human
-
Alternative names
- Matrix Metalloproteinase 11 antibody
- Matrix metalloproteinase-11 antibody
- MMP-11 antibody
see all
Images
-
All lanes : Anti-MMP11 antibody [OTI3E10] (ab236510) at 1/500 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY MMP11
Lysates/proteins at 5 µg per lane.
Predicted band size: 55 kDa -
All lanes : Anti-MMP11 antibody [OTI3E10] (ab236510) at 1/500 dilution
Lane 1 : MDA-MB-231 (human breast adenocarcinoma cell line) whole cell lysate
Lane 2 : T-47D (human ductal breast epithelial tumor cell line) whole cell lysate
Lysates/proteins at 35 µg per lane.
Predicted band size: 55 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab236510 has not yet been referenced specifically in any publications.