Anti-MMP12 antibody (ab231109)
Key features and details
- Rabbit polyclonal to MMP12
- Suitable for: WB
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-MMP12 antibody
See all MMP12 primary antibodies -
Description
Rabbit polyclonal to MMP12 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment (His-tag) corresponding to Rat MMP12 aa 372-463 (N terminal). (expressed in E.coli)
Sequence:MGHHHHHHSGSEFYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQY WRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEY DPLLH
Database link: Q63341 -
Positive control
- WB: Rat cerebrum lysate; mouse cerebrum lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231109 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 54 kDa. |
Target
-
Function
May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3. -
Tissue specificity
Found in alveolar macrophages but not in peripheral blood monocytes. -
Sequence similarities
Belongs to the peptidase M10A family.
Contains 4 hemopexin-like domains. -
Domain
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 17381 Mouse
- Entrez Gene: 117033 Rat
- SwissProt: P34960 Mouse
- SwissProt: Q63341 Rat
- Unigene: 2055 Mouse
- Unigene: 33193 Rat
-
Form
The presence of a 22kDa truncated active form of MMP-12 in vitro as well as in vivo due to the internal autolytic cleavage of the C-terminus. -
Alternative names
- EC 3.4.24.65 antibody
- HME antibody
- Macrophage elastase antibody
see all
Images
-
Western blot - Anti-MMP12 antibody (ab231109)Anti-MMP12 antibody (ab231109) at 2 µg/ml + Recombinant rat MMP12
Developed using the ECL technique.
Predicted band size: 54 kDa -
Western blot - Anti-MMP12 antibody (ab231109)Anti-MMP12 antibody (ab231109) at 2 µg/ml + Mouse cerebrum lysate
Developed using the ECL technique.
Predicted band size: 54 kDa -
Western blot - Anti-MMP12 antibody (ab231109)Anti-MMP12 antibody (ab231109) at 2 µg/ml + Rat cerebrum lysate
Developed using the ECL technique.
Predicted band size: 54 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231109 has not yet been referenced specifically in any publications.
