Overview

  • Product name

  • Description

    Rabbit polyclonal to MMP12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat MMP12 aa 372-463 (N terminal). (expressed in E.coli)
    Sequence:

    MGHHHHHHSGSEFYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQY WRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEY DPLLH


    Database link: Q63341

  • Positive control

    • WB: Rat cerebrum lysate; mouse cerebrum lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 54 kDa.

Target

  • Function

    May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3.
  • Tissue specificity

    Found in alveolar macrophages but not in peripheral blood monocytes.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Form

    The presence of a 22kDa truncated active form of MMP-12 in vitro as well as in vivo due to the internal autolytic cleavage of the C-terminus.
  • Alternative names

    • EC 3.4.24.65 antibody
    • HME antibody
    • Macrophage elastase antibody
    • Macrophage metalloelastase antibody
    • Macrophage metaloelastase antibody
    • Matrix metallopeptidase 12 (macrophage elastase) antibody
    • Matrix metalloprotease 12 antibody
    • Matrix metalloproteinase-12 antibody
    • ME antibody
    • MGC138506 antibody
    • MME antibody
    • MMP 12 antibody
    • MMP-12 antibody
    • Mmp12 antibody
    • MMP12_HUMAN antibody
    see all

Images

  • Anti-MMP12 antibody (ab231109) at 2 µg/ml + Recombinant rat MMP12

    Developed using the ECL technique.

    Predicted band size: 54 kDa

  • Anti-MMP12 antibody (ab231109) at 2 µg/ml + Mouse cerebrum lysate

    Developed using the ECL technique.

    Predicted band size: 54 kDa

  • Anti-MMP12 antibody (ab231109) at 2 µg/ml + Rat cerebrum lysate

    Developed using the ECL technique.

    Predicted band size: 54 kDa

References

ab231109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up