Anti-MMP12 antibody (ab231109)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MMP12 antibody
See all MMP12 primary antibodies -
Description
Rabbit polyclonal to MMP12 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-tag) corresponding to Rat MMP12 aa 372-463 (N terminal). (expressed in E.coli)
Sequence:MGHHHHHHSGSEFYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQY WRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEY DPLLH
Database link: Q63341 -
Positive control
- WB: Rat cerebrum lysate; mouse cerebrum lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231109 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 54 kDa. |
Target
-
Function
May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3. -
Tissue specificity
Found in alveolar macrophages but not in peripheral blood monocytes. -
Sequence similarities
Belongs to the peptidase M10A family.
Contains 4 hemopexin-like domains. -
Domain
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 17381 Mouse
- Entrez Gene: 117033 Rat
- SwissProt: P34960 Mouse
- SwissProt: Q63341 Rat
- Unigene: 2055 Mouse
- Unigene: 33193 Rat
-
Form
The presence of a 22kDa truncated active form of MMP-12 in vitro as well as in vivo due to the internal autolytic cleavage of the C-terminus. -
Alternative names
- EC 3.4.24.65 antibody
- HME antibody
- Macrophage elastase antibody
see all
Images
-
Anti-MMP12 antibody (ab231109) at 2 µg/ml + Recombinant rat MMP12
Developed using the ECL technique.
Predicted band size: 54 kDa -
Anti-MMP12 antibody (ab231109) at 2 µg/ml + Mouse cerebrum lysate
Developed using the ECL technique.
Predicted band size: 54 kDa -
Anti-MMP12 antibody (ab231109) at 2 µg/ml + Rat cerebrum lysate
Developed using the ECL technique.
Predicted band size: 54 kDa
Datasheets and documents
References
ab231109 has not yet been referenced specifically in any publications.