Overview

  • Product name

  • Description

    Guinea pig polyclonal to MMP13
  • Host species

    Guinea pig
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rabbit
    Predicted to work with: Mouse, Horse, Cow, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rabbit MMP13 aa 70-245. N-terminal tag. Expressed in E. coli.
    Sequence:

    EMQSFFGLEVTGKLDDNTLAIMKQPRCGVPDVGEYNVFPRTLKWSQTNLT YRIVNYTPDLTHSEVEKAFKKAFKVWSDVTPLNFTRIHNGTADIMISFGT KEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLV AAHEFGHSLGLDHSKDPGALMFPIYT


    Database link: O62806

  • Positive control

    • WB: Recombinant rabbit MMP13 protein; Rabbit serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab231217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 54 kDa.

Target

  • Function

    Degrades collagen type I. Does not act on gelatin or casein. Could have a role in tumoral process.
  • Tissue specificity

    Seems to be specific to breast carcinomas.
  • Involvement in disease

    Defects in MMP13 are the cause of spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO) [MIM:602111]. A bone disease characterized by moderate to severe metaphyseal changes, mild epiphyseal involvement, rhizomelic shortening of the lower limbs with bowing of the femora and/or tibiae, coxa vara, genu varum and pear-shaped vertebrae in childhood. Epimetaphyseal changes improve with age.
    Defects in MMP13 are the cause of metaphyseal anadysplasia type 1 (MANDP1) [MIM:602111]. Metaphyseal anadysplasia consists of an abnormal bone development characterized by severe skeletal changes that, in contrast with the progressive course of most other skeletal dysplasias, resolve spontaneously with age. Clinical characteristics are evident from the first months of life and include slight shortness of stature and a mild varus deformity of the legs. Patients attain a normal stature in adolescence and show improvement or complete resolution of varus deformity of the legs and rhizomelic micromelia.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • CLG 3 antibody
    • CLG3 antibody
    • Collagenase 3 antibody
    • Collagenase3 antibody
    • MANDP1 antibody
    • Matrix metallopeptidase 13 (collagenase 3) antibody
    • Matrix Metalloproteinase 13 antibody
    • Matrix metalloproteinase-13 antibody
    • MMP 13 antibody
    • MMP-13 antibody
    • Mmp13 antibody
    • MMP13_HUMAN antibody
    see all

Images

  • Anti-MMP13 antibody (ab231217) at 5 µg/ml + Rabbit serum

    Predicted band size: 54 kDa

  • Anti-MMP13 antibody (ab231217) at 2 µg/ml + Recombinant rabbit MMP13 protein

    Predicted band size: 54 kDa

References

ab231217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up