Overview

  • Product name

  • Description

    Rabbit polyclonal to MMP16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MMP16 aa 417-533.
    Sequence:

    TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEM KTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILK VEPGYPRSILKDFMGCD


    Database link: P51512

  • Positive control

    • IHC-P: Human hippocampus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. Isoform short cleaves fibronectin and also collagen type III, but at lower rate. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells.
  • Tissue specificity

    Expressed in heart, brain, placenta, ovary and small intestine. Isoform Short is found in the ovary.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Developmental stage

    Expressed in tissues undergoing reconstruction. Present in fetal tissues, especially in brain. Expression seems to decline with advanced development.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Cell membrane. Localized at the cell surface of melanoma cells and Secreted > extracellular space > extracellular matrix. Cell surface. Localized at the cell surface of melanoma cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • C8orf57 antibody
    • DKFZp761D112 antibody
    • Matrix metalloproteinase 16 antibody
    • Matrix metalloproteinase-16 antibody
    • Membrane type 3 matrix metalloproteinase antibody
    • Membrane type matrix metalloproteinase 3 antibody
    • Membrane-type matrix metalloproteinase 3 antibody
    • Membrane-type-3 matrix metalloproteinase antibody
    • MMP 16 antibody
    • MMP-16 antibody
    • MMP-X2 antibody
    • MMP16 antibody
    • MMP16_HUMAN antibody
    • MT-MMP 3 antibody
    • MT-MMP2 antibody
    • MT-MMP3 antibody
    • MT3-MMP antibody
    • MT3MMP antibody
    • MTMMP2 antibody
    • MTMMP3 antibody
    • Putative transmembrane protein C8orf57 antibody
    see all

Images

  • Paraffin-embedded human hippocampus tissue stained for MMP16 using ab223778 at 1/20 dilution in immunohistochemical analysis.

References

ab223778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up