Anti-MMP22 antibody (ab231617)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MMP22 antibody
See all MMP22 primary antibodies -
Description
Rabbit polyclonal to MMP22 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Pig
Predicted to work with: Rat, Cow
-
Immunogen
Recombinant full length protein (His-T7-tag) corresponding to Human MMP22 aa 79-390. Expressed in E. coli. N-terminal tags. Full length soluble chain.
Sequence:YTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFS FREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGG IHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRAL MHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLM KRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHK KGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRV LTTYSWRVRVRG
Database link: O75900-1 -
Positive control
- IHC-P: Human breast cancer, glioma, prostate cancer, prostate, stomach and colorectal cancer tissue. WB: PC-3 cell lysate. Pig stomach and large intestine tissue lysate. Recombinant human MMP22 protein.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography -
Clonality
Polyclonal -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231617 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 44 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Protease. May regulate the surface expression of some potassum channels by retaining them in the endoplasmic reticulum. -
Tissue specificity
Predominantly expressed in ovary, testis and prostate. -
Sequence similarities
Belongs to the peptidase M10A family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
Domain
The toxin-like domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4. -
Post-translational
modificationsN-glycosylated.
Proteolytic cleavage might yield an active form. -
Cellular localization
Endoplasmic reticulum membrane. Membrane. A secreted form produced by proteolytic cleavage may also exist. - Information by UniProt
-
Database links
- Entrez Gene: 8510 Human
- Entrez Gene: 94339 Rat
- Omim: 603321 Human
- SwissProt: O75900 Human
- SwissProt: O88272 Rat
- Unigene: 192316 Human
- Unigene: 671760 Human
- Unigene: 22562 Rat
-
Alternative names
- Femalysin antibody
- Matrix metallopeptidase 21 antibody
- matrix metallopeptidase 23B antibody
see all
Images
-
Western blot - Anti-MMP22 antibody (ab231617)Anti-MMP22 antibody (ab231617) at 2 µg/ml + Recombinant human MMP22 protein
Predicted band size: 44 kDa -
Western blot - Anti-MMP22 antibody (ab231617)All lanes : Anti-MMP22 antibody (ab231617) at 1 µg/ml
Lane 1 : PC-3 (Human prostate adenocarcinoma cell line) cell lysate
Lane 2 : Pig stomach tissue lysate
Lane 3 : Pig large intestine tissue lysate
Secondary
All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 44 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP22 antibody (ab231617)Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for MMP22 with ab231617 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP22 antibody (ab231617)Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for MMP22 with ab231617 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP22 antibody (ab231617)Formalin-fixed, paraffin-embedded human stomach tissue stained for MMP22 with ab231617 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP22 antibody (ab231617)Formalin-fixed, paraffin-embedded human glioma tissue stained for MMP22 with ab231617 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP22 antibody (ab231617)Formalin-fixed, paraffin-embedded human breast cancer tissue stained for MMP22 with ab231617 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP22 antibody (ab231617)Formalin-fixed, paraffin-embedded human prostate tissue stained for MMP22 with ab231617 at 30 µg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab231617 has not yet been referenced specifically in any publications.
