Anti-MMP24 antibody (ab233004)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MMP24 antibody -
Description
Rabbit polyclonal to MMP24 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human MMP24 aa 429-642. Two N-terminal tags. (Expressed in E.coli).
Sequence:IDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDT ALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAF ISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRK ERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNK TGPQPVTYYKRPVQ
Database link: Q9Y5R2 -
Positive control
- WB: Rat pancreas, cerebrum and kidney lysate; Human liver lysate; Recombinant human MMP24 protein. IHC-P: Human prostate, kidney, skin cancer, colorectal cancer, liver and stomach cancer tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233004 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.2 - 2 µg/ml. |
Target
-
Function
Activates progelatinase A. May also be a proteoglycanase involved in degradation of proteoglycans, such as dermatan sulfate and chondroitin sulfate proteoglycans. Cleaves partially fibronectin, but not collagen type I, nor laminin. -
Tissue specificity
Predominantly expressed in brain, kidney, pancreas and lung. Overexpressed in a series of brain tumors, including astrocytomas and glioblastomas. -
Sequence similarities
Belongs to the peptidase M10A family.
Contains 4 hemopexin-like domains. -
Domain
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Post-translational
modificationsThe precursor is cleaved by a furin endopeptidase. -
Cellular localization
Cell membrane and Secreted > extracellular space > extracellular matrix. Also shed from cell surface as soluble proteinase, by a proteolytic cleavage. - Information by UniProt
-
Database links
- Entrez Gene: 10893 Human
- Entrez Gene: 17391 Mouse
- Entrez Gene: 83513 Rat
- Omim: 604871 Human
- SwissProt: Q9Y5R2 Human
- SwissProt: Q9R0S2 Mouse
- SwissProt: Q99PW6 Rat
- Unigene: 715494 Human
see all -
Alternative names
- Matrix metallopeptidase 24 (membrane inserted) antibody
- Matrix metallopeptidase 24 antibody
- Membrane type 5 matrix metalloproteinase antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)Formalin-fixed, paraffin-embedded human liver tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)Formalin-fixed, paraffin-embedded human skin cancer tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)Formalin-fixed, paraffin-embedded human kidney tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)Formalin-fixed, paraffin-embedded human prostate tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-MMP24 antibody (ab233004)Anti-MMP24 antibody (ab233004) at 1.5 µg/ml + Rat kidney lysate -
Western blot - Anti-MMP24 antibody (ab233004)Anti-MMP24 antibody (ab233004) at 1.5 µg/ml + Rat cerebrum lysate -
Western blot - Anti-MMP24 antibody (ab233004)Anti-MMP24 antibody (ab233004) at 2 µg/ml + Human liver lysate -
Western blot - Anti-MMP24 antibody (ab233004)Anti-MMP24 antibody (ab233004) at 1.5 µg/ml + Rat pancreas lysate -
Western blot - Anti-MMP24 antibody (ab233004)Anti-MMP24 antibody (ab233004) at 2 µg/ml + Recombinant human MMP24 protein
Datasheets and documents
References
ab233004 has not yet been referenced specifically in any publications.
