Anti-MMP24 antibody (ab233004)
Key features and details
- Rabbit polyclonal to MMP24
- Suitable for: IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-MMP24 antibody -
Description
Rabbit polyclonal to MMP24 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human MMP24 aa 429-642. Two N-terminal tags. (Expressed in E.coli).
Sequence:IDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDT ALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAF ISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRK ERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNK TGPQPVTYYKRPVQ
Database link: Q9Y5R2 -
Positive control
- WB: Rat pancreas, cerebrum and kidney lysate; Human liver lysate; Recombinant human MMP24 protein. IHC-P: Human prostate, kidney, skin cancer, colorectal cancer, liver and stomach cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233004 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. |
Target
-
Function
Activates progelatinase A. May also be a proteoglycanase involved in degradation of proteoglycans, such as dermatan sulfate and chondroitin sulfate proteoglycans. Cleaves partially fibronectin, but not collagen type I, nor laminin. -
Tissue specificity
Predominantly expressed in brain, kidney, pancreas and lung. Overexpressed in a series of brain tumors, including astrocytomas and glioblastomas. -
Sequence similarities
Belongs to the peptidase M10A family.
Contains 4 hemopexin-like domains. -
Domain
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Post-translational
modificationsThe precursor is cleaved by a furin endopeptidase. -
Cellular localization
Cell membrane and Secreted > extracellular space > extracellular matrix. Also shed from cell surface as soluble proteinase, by a proteolytic cleavage. - Information by UniProt
-
Database links
- Entrez Gene: 10893 Human
- Entrez Gene: 17391 Mouse
- Entrez Gene: 83513 Rat
- Omim: 604871 Human
- SwissProt: Q9Y5R2 Human
- SwissProt: Q9R0S2 Mouse
- SwissProt: Q99PW6 Rat
- Unigene: 715494 Human
see all -
Alternative names
- Matrix metallopeptidase 24 (membrane inserted) antibody
- Matrix metallopeptidase 24 antibody
- Membrane type 5 matrix metalloproteinase antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)
Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)
Formalin-fixed, paraffin-embedded human liver tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)
Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)
Formalin-fixed, paraffin-embedded human skin cancer tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)
Formalin-fixed, paraffin-embedded human kidney tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMP24 antibody (ab233004)
Formalin-fixed, paraffin-embedded human prostate tissue stained for MMP24 using ab233004 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-MMP24 antibody (ab233004) at 1.5 µg/ml + Rat kidney lysate
-
Anti-MMP24 antibody (ab233004) at 1.5 µg/ml + Rat cerebrum lysate
-
Anti-MMP24 antibody (ab233004) at 2 µg/ml + Human liver lysate
-
Anti-MMP24 antibody (ab233004) at 1.5 µg/ml + Rat pancreas lysate
-
Anti-MMP24 antibody (ab233004) at 2 µg/ml + Recombinant human MMP24 protein
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233004 has not yet been referenced specifically in any publications.