Overview

  • Product name

    Anti-MMP7 antibody - C-terminal
    See all MMP7 primary antibodies
  • Description

    Rabbit polyclonal to MMP7 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human MMP7 aa 218-267 (C terminal).
    Sequence:

    HSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK


    Database link: P09237

  • Positive control

    • Human uterus tissue and COS7 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab189277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 30 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
  • Sequence similarities

    Belongs to the peptidase M10A family.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Matrilysin antibody
    • Matrin antibody
    • Matrix Metalloproteinase 7 antibody
    • Matrix metalloproteinase-7 antibody
    • MMP 7 antibody
    • MMP-7 antibody
    • MMP7 antibody
    • MMP7_HUMAN antibody
    • MPSL1 antibody
    • PUMP 1 antibody
    • Pump 1 protease antibody
    • Pump-1 protease antibody
    • PUMP1 antibody
    • Uterine matrilysin antibody
    • Uterine metalloproteinase antibody
    see all

Images

  • All lanes : Anti-MMP7 antibody - C-terminal (ab189277) at 1/500 dilution

    Lane 1 : COS7 cell lysate
    Lane 2 : COS7 cell lysate with synthesized peptide

    Predicted band size: 30 kDa

  • Immunohistochemistry of formalin-fixed, paraffin-embedded Human uterus tissue labeling MMP7 with ab189277 at 10 µg/ml.

References

This product has been referenced in:

  • Zhang X  et al. Rosmarinic acid alleviates cardiomyocyte apoptosis via cardiac fibroblast in doxorubicin-induced cardiotoxicity. Int J Biol Sci 15:556-567 (2019). Read more (PubMed: 30745842) »
  • Zhu J  et al. Advanced glycosylation end product promotes forkhead box O1 and inhibits Wnt pathway to suppress capacities of epidermal stem cells. Am J Transl Res 8:5569-5579 (2016). Read more (PubMed: 28078027) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up