Overview

  • Product name

  • Description

    Rabbit polyclonal to MMS19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MMS19 aa 680-770.
    Sequence:

    IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNV EIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA


    Database link: Q96T76

  • Positive control

    • Human testis tissue; RT-4 and Y-251 MG sp cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab188156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 113 kDa.

Target

  • Function

    May play a role in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription by interacting with ERCC2/XPD and ERCC3/XPB helicases, both subunits of NER-transcription factor TFIIH. May also function as a transcriptional coactivator of estrogen receptor (ER). May be involved in regulation of ER activity by bridging TFIIH with ER or may facilitate TFIIH-mediated phosphorylation of ER in specific promoters and cell types. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation.
  • Tissue specificity

    Ubiquitously expressed with higher expression in testis.
  • Sequence similarities

    Belongs to the MET18/MMS19 family.
    Contains 7 HEAT repeats.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • hMMS19 antibody
    • homolog of yeast MMS19 antibody
    • MET18 antibody
    • MET18 homolog antibody
    • MET18MMS19 nucleotide excision repair homolog (S. cerevisiae) antibody
    • mms19 antibody
    • MMS19 nucleotide excision repair protein homolog antibody
    • MMS19 nucleotide excision repair, S. cerevisiae, homolog of antibody
    • MMS19-like (MET18 homolog, S. cerevisiae) antibody
    • MMS19-like protein antibody
    • MMS19_HUMAN antibody
    • MMS19L antibody
    see all

Images

  • All lanes : Anti-MMS19 antibody (ab188156) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG sp cell lysate

    Predicted band size: 113 kDa

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue, labeling MMS19 using ab188156 at a 1/50 dilution.

References

This product has been referenced in:

  • Upadhyay AS  et al. Cellular requirements for iron-sulfur cluster insertion into the antiviral radical SAM protein viperin. J Biol Chem 292:13879-13889 (2017). Read more (PubMed: 28615450) »
  • Moiseeva TN  et al. Human DNA polymerase e is phosphorylated at serine-1940 after DNA damage and interacts with the iron-sulfur complex chaperones CIAO1 and MMS19. DNA Repair (Amst) 43:9-17 (2016). Read more (PubMed: 27235625) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up