Overview

  • Product name

  • Description

    Rabbit Polyclonal to MMS19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human MMS19 aa 930-975 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAAL


    Database link: Q96T76

  • Positive control

    • Human breast carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    May play a role in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription by interacting with ERCC2/XPD and ERCC3/XPB helicases, both subunits of NER-transcription factor TFIIH. May also function as a transcriptional coactivator of estrogen receptor (ER). May be involved in regulation of ER activity by bridging TFIIH with ER or may facilitate TFIIH-mediated phosphorylation of ER in specific promoters and cell types. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation.
  • Tissue specificity

    Ubiquitously expressed with higher expression in testis.
  • Sequence similarities

    Belongs to the MET18/MMS19 family.
    Contains 7 HEAT repeats.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • hMMS19 antibody
    • homolog of yeast MMS19 antibody
    • MET18 antibody
    • MET18 homolog antibody
    • MET18MMS19 nucleotide excision repair homolog (S. cerevisiae) antibody
    • mms19 antibody
    • MMS19 nucleotide excision repair protein homolog antibody
    • MMS19 nucleotide excision repair, S. cerevisiae, homolog of antibody
    • MMS19-like (MET18 homolog, S. cerevisiae) antibody
    • MMS19-like protein antibody
    • MMS19_HUMAN antibody
    • MMS19L antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast carcinoma tissue labeling MMS19 with ab214328 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab214328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up