Overview

  • Product name

  • Description

    Rabbit polyclonal to MMS21
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MMS21 aa 1-247.
    Sequence:

    MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVE SQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDL KLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADG TEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIES RQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE


    Database link: Q96MF7

  • Positive control

    • IHC-P: Human melanoma tissue.
  • General notes

    Previously labelled as NSE2.

Properties

Applications

Our Abpromise guarantee covers the use of ab237530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Function

    E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. Acts as a E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TRAX, and maybe the cohesin components RAD21 and STAG2. SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair.
  • Pathway

    Protein modification; protein sumoylation.
  • Sequence similarities

    Belongs to the NSE2 family.
    Contains 1 SP-RING-type zinc finger.
  • Post-translational
    modifications

    Sumoylated, possibly via autosumoylation.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • C8orf36 antibody
    • E3 SUMO-protein ligase NSE2 antibody
    • hMMS21 antibody
    • hNSE2 antibody
    • methyl methanesulfonate sensitivity gene 21 antibody
    • MMS21 antibody
    • MMS21 homolog antibody
    • non-SMC element 2 antibody
    • Non-SMC element 2 homolog antibody
    • Non-structural maintenance of chromosomes element 2 homolog antibody
    • NSE2 antibody
    • NSE2_HUMAN antibody
    • Nsmce2 antibody
    see all

Images

  • Paraffin-embedded human melanoma tissue stained for MMS21 with ab237530 at a 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab237530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up