Anti-MNAT1 antibody (ab175398)
Key features and details
- Rabbit polyclonal to MNAT1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-MNAT1 antibody
See all MNAT1 primary antibodies -
Description
Rabbit polyclonal to MNAT1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P RatWB Human
-
Immunogen
Recombinant full length protein corresponding to Human MNAT1 aa 1-309.
Sequence:MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE EVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEA LEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQ HKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQP LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA FSGLFWQPS
Database link: P51948 -
Positive control
- A431 and Hela cell extracts.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175398 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
| Application | Species |
|---|---|
| ICC/IF |
Human
|
| IHC-P |
Rat
|
| WB |
Human
|
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF |
Use at an assay dependent concentration.
|
|
| WB |
1/500 - 1/2000. Predicted molecular weight: 36 kDa.
|
|
| IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
| Notes |
|---|
|
ICC/IF
Use at an assay dependent concentration. |
|
WB
1/500 - 1/2000. Predicted molecular weight: 36 kDa. |
|
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. -
Tissue specificity
Highest levels in colon and testis. Moderate levels are present thymus, prostate, ovary, and small intestine. The lowest levels are found in spleen and leukocytes. -
Sequence similarities
Contains 1 RING-type zinc finger.
Contains 1 UIM (ubiquitin-interacting motif) repeat. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 4331 Human
- Entrez Gene: 266713 Rat
- Omim: 602659 Human
- SwissProt: P51948 Human
- Unigene: 509523 Human
- Unigene: 15168 Rat
-
Alternative names
- MNAT 1 antibody
- CAP35 antibody
- CDK activating kinase assembly factor MAT1 antibody
see all
Images
-
Western blot - Anti-MNAT1 antibody (ab175398)All lanes : Anti-MNAT1 antibody (ab175398) at 1/500 dilution
Lane 1 : A431 cell extract
Lane 2 : Hela cell extract
Predicted band size: 36 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MNAT1 antibody (ab175398)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat brain tissue labelling MNAT1 with ab175398 at 1/200. Magnification: 200x. -
Immunocytochemistry/ Immunofluorescence - Anti-MNAT1 antibody (ab175398)Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175398. Blue DAPI for nuclear staining.
Protocols
Datasheets and documents
References (0)
ab175398 has not yet been referenced specifically in any publications.
