Anti-MNAT1 antibody (ab175398)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-MNAT1 antibody
See all MNAT1 primary antibodies -
DescriptionRabbit polyclonal to MNAT1
-
Host speciesRabbit
-
Tested applicationsSuitable for: ICC/IF, WB, IHC-Pmore details
-
Species reactivityReacts with: Mouse, Rat, Human
-
Immunogen
Recombinant full length protein corresponding to Human MNAT1 aa 1-309.
Sequence:MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE EVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEA LEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQ HKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQP LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA FSGLFWQPS
Database link: P51948 -
Positive control
- A431 and Hela cell extracts.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferpH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
PurityProtein A purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab175398 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use at an assay dependent concentration. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 36 kDa. | |
IHC-P | 1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Target
-
FunctionStabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II.
-
Tissue specificityHighest levels in colon and testis. Moderate levels are present thymus, prostate, ovary, and small intestine. The lowest levels are found in spleen and leukocytes.
-
Sequence similaritiesContains 1 RING-type zinc finger.
Contains 1 UIM (ubiquitin-interacting motif) repeat. -
Cellular localizationNucleus.
- Information by UniProt
-
Database links
- Entrez Gene: 4331 Human
- Entrez Gene: 17420 Mouse
- Entrez Gene: 266713 Rat
- Omim: 602659 Human
- SwissProt: P51948 Human
- SwissProt: P51949 Mouse
- Unigene: 509523 Human
- Unigene: 246750 Mouse
see all -
Alternative names
- MNAT 1 antibody
- CAP35 antibody
- CDK activating kinase assembly factor MAT1 antibody
see all
Images
-
All lanes : Anti-MNAT1 antibody (ab175398) at 1/500 dilution
Lane 1 : A431 cell extract
Lane 2 : Hela cell extract
Predicted band size: 36 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MNAT1 antibody (ab175398)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat brain tissue labelling MNAT1 with ab175398 at 1/200. Magnification: 200x.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175398. Blue DAPI for nuclear staining.
Protocols
Datasheets and documents
References
ab175398 has not yet been referenced specifically in any publications.