Anti-MND1 antibody (ab235395)
Key features and details
- Rabbit polyclonal to MND1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MND1 antibody -
Description
Rabbit polyclonal to MND1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow -
Immunogen
Recombinant full length protein corresponding to Human MND1 aa 2-205.
Sequence:SKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVL QSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHA SLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQV VEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDF DYID
Database link: Q9BWT6 -
Positive control
- WB: Jurkat whole cell lysate. IHC-P: Human gastric cancer and endometrial cancer tissue.
-
General notes
This product was previously labelled as GAJ
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235395 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. | |
IHC-P | 1/20 - 1/200. |
Target
-
Relevance
The product of the MND1 gene associates with HOP2 to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 and DMC1 (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 618239 Cow
- Entrez Gene: 84057 Human
- Entrez Gene: 76915 Mouse
- Omim: 611422 Human
- SwissProt: Q32L19 Cow
- SwissProt: Q9BWT6 Human
- SwissProt: Q8K396 Mouse
- Unigene: 294088 Human
-
Alternative names
- 2610034E18Rik antibody
- AI591601 antibody
- GAJ protein antibody
see all
Images
-
Anti-MND1 antibody (ab235395) at 1/1000 dilution + Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MND1 antibody (ab235395)
Paraffin-embedded human gastric cancer tissue stained for MND1 with ab235395 (1/100 dilution) in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MND1 antibody (ab235395)
Paraffin-embedded human endometrial cancer tissue stained for MND1 with ab235395 (1/100 dilution) in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235395 has not yet been referenced specifically in any publications.