Overview

  • Product name

  • Description

    Rabbit polyclonal to MNF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human MNF1 aa 14-126. Mature chain lacking the transit peptide.
    Sequence:

    EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARL HSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQE KFAPKGPEEDHKA


    Database link: Q9BRT2

  • Positive control

    • WB: A431 whole cell lysate. IHC-P: Human heart and liver tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 15 kDa.
IHC-P 1/20 - 1/200.

Target

  • Cellular localization

    Mitochondrion matrix › mitochondrion nucleoid
  • Database links

  • Alternative names

    • bA6B20.2 antibody
    • Breast cancer-associated protein SGA-81M antibody
    • C6orf125 antibody
    • Cbp6 antibody
    • M19 antibody
    • Mitochondrial nucleoid factor 1 antibody
    • Mitochondrial protein M19 antibody
    • MNF1 antibody
    • RP11-6B20.2 antibody
    • Ubiquinol cytochrome c reductase complex assembly factor 2 antibody
    • UQCC2 antibody
    see all

Images

  • Anti-MNF1 antibody (ab234861) at 1/1000 dilution + A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 15 kDa

  • Paraffin-embedded human heart tissue stained for MNF1 using ab234861 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for MNF1 using ab234861 at 1/100 dilution in immunohistochemical analysis.

References

ab234861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up