Overview

  • Product name

  • Description

    Rabbit polyclonal to MnSOD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human MnSOD aa 25-222. Full length mature chain without transit peptide. Expressed in E.coli. N-terminal tags.
    Sequence:

    KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALA KGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRD FGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTT GLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK


    Database link: P04179-1

  • Positive control

    • WB: Recombinant human MnSOD protein; Human serum; Pig liver and brain lysates; HeLa and MCF7 cell lysates. IHC-P: Human liver, prostate cancer, breast cancer, kidney, skin cancer and colorectal cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function

    Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
  • Involvement in disease

    Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities

    Belongs to the iron/manganese superoxide dismutase family.
  • Post-translational
    modifications

    Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • IPOB antibody
    • Manganese superoxide dismutase antibody
    • mitochondrial antibody
    • SOD2 antibody
    • SODM_HUMAN antibody
    • Superoxide dismutase [Mn] antibody
    • Superoxide dismutase [Mn] mitochondrial precursor antibody
    • Superoxide dismutase 2 mitochondrial antibody
    see all

Images

  • All lanes : Anti-MnSOD antibody (ab232961) at 2 µg/ml

    Lane 1 : Human serum
    Lane 2 : Pig liver lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : Pig brain lysate
    Lane 5 : MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 25 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for MnSOD using ab232961 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for MnSOD using ab232961 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for MnSOD using ab232961 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for MnSOD using ab232961 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for MnSOD using ab232961 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for MnSOD using ab232961 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-MnSOD antibody (ab232961) at 2 µg/ml + Recombinant human MnSOD protein

    Predicted band size: 25 kDa

References

ab232961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up