Overview

  • Product name

  • Description

    Rabbit polyclonal to Mob1A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Mob1A aa 8-41.
    Sequence:

    RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL


    Database link: Q9H8S9

  • Positive control

    • ICC/IF: RH-30 cells.
  • General notes

     This product was previously labelled as MOBK1B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab221988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Function

    Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L.
  • Tissue specificity

    Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
  • Sequence similarities

    Belongs to the MOB1/phocein family.
  • Information by UniProt
  • Database links

  • Alternative names

    • B1, Mps One Binder kinase activator like 1B (yeast) antibody
    • C2orf6 antibody
    • Chromosome 2 open reading frame 6 antibody
    • FLJ10788 antibody
    • FLJ11595 antibody
    • MATS1 antibody
    • MOB kinase activator 1A antibody
    • MOB1 antibody
    • Mob1 alpha antibody
    • Mob1 homolog 1B antibody
    • MOB1 Mps One Binder homolog A antibody
    • MOB1 Mps One Binder kinase activator like 1B antibody
    • Mob1A antibody
    • MOB4B antibody
    • Mob4B protein antibody
    • MOBK1B antibody
    • Mobkl1b antibody
    • MOL1B_HUMAN antibody
    • Mps one binder kinase activator like 1B antibody
    • Mps one binder kinase activator-like 1B antibody
    • Protein Mob4B antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for Mob1A (green) using ab221988 at 4 µg/ml in ICC/IF.

References

ab221988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up