Overview

  • Product name

  • Description

    Rabbit polyclonal to MOCS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human MOCS2 aa 1-188.
    Sequence:

    MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFT AEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAE NERKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAV SYAIDTLKAKVPWKKEIYEESSTWKGNKECFWASNS


    Database link: O96007

  • Positive control

    • WB: A549, HepG2 and Jurkat whole cell lysatses. IHC-P: Human kidney and adrenal gland tissues. IP: Jurkat whole cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab230013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa).
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    The large (MOCS2B) and small (MOCS2A) subunits of molybdopterin synthase are both encoded from the MOCS2 gene by overlapping open reading frames. MOCS2B is the catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. It acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • MCBPE antibody
    • MOCO1 antibody
    • MOCO1 B antibody
    • MOCO1B antibody
    • MOCS 2 antibody
    • MOCS2 antibody
    • MOCS2A antibody
    • MOCS2B antibody
    • Molybdenum cofactor biosynthesis protein E antibody
    • Molybdenum cofactor synthesis 2 antibody
    • Molybdenum cofactor synthesis protein 2 large subunit antibody
    • molybdenum cofactor synthesis protein 2 small subunit antibody
    • molybdenum cofactor synthesis protein 2A antibody
    • Molybdenum cofactor synthesis protein 2B antibody
    • Molybdopterin synthase antibody
    • Molybdopterin synthase large subunit antibody
    • molybdopterin-synthase small subunit antibody
    • MPT synthase antibody
    • MPTS antibody
    • OTTHUMP00000122459 antibody
    • sulfur carrier protein MOCS2A antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for MOCS2 (green) using ab230013 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

  • MOCS2 was immunoprecipitated from 500 µg Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate with 4 µg of ab230013.

    Lane 1: 1 µg of rabbit monoclonal IgG instead of ab230013 in Jurkat whole cell lysate.

    Lane 2: ab230013 IP in jurkat whole cell lysate.

    Lane 3: Jurkat whole cell lysate 20 µg (input).

    For western blotting, an HRP-conjugated light chain specific antibody was used as the Secondary antibody at 1/50000 dilution.

  • Paraffin-embedded human adrenal gland tissue stained for MOCS2 using ab230013 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for ab230013 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-MOCS2 antibody (ab230013) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 21 kDa
    Observed band size: 21 kDa

References

ab230013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up