Overview

  • Product name

  • Description

    Rabbit polyclonal to MOCS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MOCS3 aa 271-460.
    Sequence:

    YSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSA TDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHA LHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY


    Database link: O95396

  • Positive control

    • WB: A549, HepG2 and Jurkat whole cell lysates. IHC-P: Human liver and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa).

Target

  • Function

    Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.
  • Pathway

    tRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis.
    Cofactor biosynthesis; molybdopterin biosynthesis.
  • Sequence similarities

    In the N-terminal section; belongs to the hesA/moeB/thiF family. UBA4 subfamily.
    Contains 1 rhodanese domain.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adenylyltransferase MOCS3 antibody
    • dJ914P20.3 antibody
    • MGC9252 antibody
    • MOCS 3 antibody
    • MOCS3 antibody
    • MOCS3_HUMAN antibody
    • Molybdenum cofactor synthesis 3 antibody
    • Molybdenum cofactor synthesis protein 3 antibody
    • Molybdopterin synthase sulfurylase antibody
    • Molybdopterin-synthase sulfurtransferase antibody
    • MPT synthase sulfurylase antibody
    • Sulfur carrier protein MOCS2A adenylyltransferase antibody
    • Sulfur carrier protein MOCS2A sulfurtransferase antibody
    • Sulfurtransferase MOCS3 antibody
    • UBA 4 antibody
    • UBA4 ubiquitin activating enzyme E1 homolog antibody
    • UBA4 antibody
    see all

Images

  • All lanes : Anti-MOCS3 antibody (ab229827) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 50 kDa
    Observed band size: 50 kDa

  • Paraffin-embedded human liver tissue stained for MOCS3 using ab229827 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for MOCS3 using ab229827 at 1/100 dilution in immunohistochemical analysis.

References

ab229827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up