Overview

  • Product name

  • Description

    Rabbit polyclonal to MOGAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human MOGAT1 aa 288-337 (C terminal).
    Sequence:

    PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK


    Database link: NP_477513

  • Positive control

    • Fetal liver lysate.
  • General notes

    Previously labelled as MOGT1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

  • Function

    Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine.
  • Pathway

    Glycerolipid metabolism; triacylglycerol biosynthesis.
  • Sequence similarities

    Belongs to the diacylglycerol acyltransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610030A14Rik antibody
    • 1110064N14Rik antibody
    • 2-acylglycerol O-acyltransferase 1 antibody
    • Acyl CoA:monoacylglycerol acyltransferase 1 antibody
    • Acyl-CoA:monoacylglycerol acyltransferase 1 antibody
    • DGAT2L antibody
    • DGAT2L1 antibody
    • Diacylglycerol acyltransferase 2 like antibody
    • Diacylglycerol acyltransferase 2-like protein 1 antibody
    • Diacylglycerol O acyltransferase 2 like 1 antibody
    • Diacylglycerol O-acyltransferase candidate 2 antibody
    • hDC2 antibody
    • mDC2 antibody
    • MGAT1 antibody
    • MGC118035 antibody
    • MOGAT1 antibody
    • MOGT1 antibody
    • MOGT1_HUMAN antibody
    • Monoacylglycerol O acyltransferase 1 antibody
    • Monoacylglycerol O-acyltransferase 1 antibody
    • OTTMUSP00000025181 antibody
    see all

Images

  • Anti-MOGAT1 antibody (ab81177) at 1 µg/ml + fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 39 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?

References

ab81177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Tissue lysate - whole (stomach)
Gel Running Conditions
Reduced Denaturing
Loading amount
60 µg
Treatment
RIPA buffer is used for lysis buffer
Specification
stomach
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 08 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up