Overview

  • Product name

    Anti-Monoacylglycerol Lipase/MGL antibody
    See all Monoacylglycerol Lipase/MGL primary antibodies
  • Description

    Rabbit polyclonal to Monoacylglycerol Lipase/MGL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Monoacylglycerol Lipase/MGL aa 1-303. (Expressed in E.coli).
    Sequence:

    MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG AGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDV LQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVL ANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLL MELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA SPP


    Database link: Q99685

  • Positive control

    • WB: Mouse liver lysate; Recombinant human Monoacylglycerol Lipase/MGL protein. IHC-P: Human liver tissue.
  • General notes

     This product was previously labelled as Monoacylglycerol Lipase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Function

    Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
  • Tissue specificity

    Detected in adipose tissue, lung, liver, kidney, brain and heart.
  • Pathway

    Glycerolipid metabolism; triacylglycerol degradation.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 3.1.1.23 antibody
    • HU K5 antibody
    • HU-K5 antibody
    • HUK5 antibody
    • Lysophospholipase homolog antibody
    • Lysophospholipase like antibody
    • Lysophospholipase-like antibody
    • MAGL antibody
    • MGL antibody
    • MGLL antibody
    • MGLL_HUMAN antibody
    • Monoacylglycerol lipase antibody
    • Monoglyceride lipase antibody
    see all

Images

  • Anti-Monoacylglycerol Lipase/MGL antibody (ab232998) at 2 µg/ml + Recombinant human Monoacylglycerol lipase/MGL protein

    Predicted band size: 33 kDa

  • Anti-Monoacylglycerol Lipase/MGL antibody (ab232998) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 33 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Monoacylglycerol Lipase/MGL using ab232998 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232998 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up