Overview

  • Product name

    Anti-Monoamine Oxidase A/MAO-A antibody
    See all Monoamine Oxidase A/MAO-A primary antibodies
  • Description

    Rabbit polyclonal to Monoamine Oxidase A/MAO-A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Monoamine Oxidase A/MAO-A aa 1-497. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGG RTYTVRNEHVKWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQY VKGKTYPFRGAFPPVWNPLAYLDYNNLWRTMDEMGKEIPVDAPWQARHAQ EWDKMTMKDLIDKICWTKTAREFAYLFVNINVTSEPHEVSALWFLWYVRQ CGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKLSSPVTYIDQT DDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPM GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPIAITLDDTKPDGSLPAIM GFILARKADRQAKLHKDIRKRKICELYAKVLGSQEALYPVHYEEKNWCEE QYSGGCYTAYFPPGIMTQYGRVIRQPVGRIYFAGTETATQWSGYMEGAVE AGERAAREVLNALGKVAKKDIWVEEPESKDVPAIEITHTFLERNLPS


    Database link: P21396

  • Positive control

    • IHC-P: Rat adrenal gland and liver tissue. WB: Recombinant rat Monoamine Oxidase A/MAO-A protein; Rat serum; Rat liver and kidney tissue lysate.
  • General notes

    Previously labelled as Monoamine Oxidase A. 

Properties

Applications

Our Abpromise guarantee covers the use of ab232845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
  • Tissue specificity

    Heart, liver, duodenum, blood vessels and kidney.
  • Involvement in disease

    Defects in MAOA are the cause of Brunner syndrome (BRUNS) [MIM:300615]. Brunner syndrome is a form of X-linked non-dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior.
  • Sequence similarities

    Belongs to the flavin monoamine oxidase family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Amine oxidase [flavin containing] A antibody
    • Amine oxidase [flavin-containing] A antibody
    • AOFA antibody
    • AOFA_HUMAN antibody
    • EC 1.4.3.4 antibody
    • MAO A antibody
    • MAO-A antibody
    • maoA antibody
    • Monoamine oxidase A antibody
    • Monoamine oxidase type A antibody
    see all

Images

  • Anti-Monoamine Oxidase A/MAO-A antibody (ab232845) at 1 µg/ml + Rat kidney lysate
  • Anti-Monoamine Oxidase A/MAO-A antibody (ab232845) at 1 µg/ml + Rat serum.
  • Anti-Monoamine Oxidase A/MAO-A antibody (ab232845) at 1 µg/ml + Rat liver lysate.
  • Anti-Monoamine Oxidase A/MAO-A antibody (ab232845) at 2 µg/ml + Recombinant rat Monoamine Oxidase A/MAO-A protein.
  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Monoamine Oxidase A/MAO-A using ab232845 at 30 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat adrenal gland tissue stained for Monoamine Oxidase A/MAO-A using ab232845 at 30 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up