Overview

  • Product name

    Anti-MORC1 antibody
  • Description

    Rabbit polyclonal to MORC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MORC1 aa 683-984.
    Sequence:

    RAQPTEGCLKNAQAASWEMKRKQSLNFVEECKVLTEDENTSDSDIILVSD KSNTDVSLKQEKKEIPLLNQEKQELCNDVLAMKRSSSLPSWKSLLNVPME DVNLSSGHIARVSVSGSCKVASSPASSQSTPVKETVRKLKSKLREILLYF FPEHQLPSELEEPALSCELEQCPEQMNKKLKMCFNQIQNTYMVQYEKKIK RKLQSIIYDSNTRGIHNEISLGQCENKRKISEDKLKNLRIKLALLLQKLQ LGGPEGDLEQTDTYLEALLKEDNLLFQNNLNKVTIDARHRLPLEKNEKTS EN


    Database link: Q86VD1-1

  • Positive control

    • IHC-P: Human testis and cervical cancer tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    MORC1 is the Human homolog of Mouse MORC and like the mouse protein it is testis-specific. Mouse studies support a testis-specific function since only male knockout mice are infertile; infertility is the only apparent defect. These studies further support a role for this protein early in spermatogenesis, possibly by affecting entry into apoptosis because testis from knockout mice show greatly increased numbers of apoptotic cells.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Cancer/testis antigen 33 antibody
    • CT33 antibody
    • CW type zinc finger 1 antibody
    • Microrchidia (mouse) homolog antibody
    • Microrchidia homolog (mouse) antibody
    • Microrchidia, mouse, homolog of antibody
    • MORC 1 antibody
    • MORC family CW type zinc finger protein 1 antibody
    • MORC1 antibody
    • ZCW6 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for MORC1 (green) using ab229883 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for MORC1 using ab229883 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cervical cancer tissue stained for MORC1 using ab229883 at 1/100 dilution in immunohistochemical analysis.

References

ab229883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up