Overview

  • Product name

    Anti-MORN2/MOPT antibody - N-terminal
  • Description

    Rabbit polyclonal to MORN2/MOPT - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MORN2/MOPT aa 1-76 (N terminal).
    Sequence:

    MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGE GEYTDIQGLEWSGNFHFTAAPDLKLK


    Database link: Q502X0

  • Positive control

    • Human thyroid gland and liver cancer tissue.
  • General notes

     This product was previously labelled as MORN2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/200 - 1/500.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human thyroid gland tissue, labeling MORN2/MOPT using ab188524 at a 1/200 dilution.

  • Immunofluorescent staining of human cell line MCF7 using ab188524 at 1/200 shows localization to nucleoplasm. Antibody staining is shown in green. 

  • Immunohistochemical analysis of paraffin-embedded Human thyroid gland tissue, labeling MORN2/MOPT using ab188524 at a 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue, labeling MORN2/MOPT using ab188524 at a 1/200 dilution.

References

ab188524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up