Overview

  • Product name

  • Description

    Rabbit polyclonal to MOS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MOS aa 234-330.
    Sequence:

    TPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGER QHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPS


    Database link: P00540

  • Positive control

    • WB: Jurkat whole cell lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/300 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 38 kDa.

Target

  • Tissue specificity

    Expressed specifically in testis during spermatogenesis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • c mos antibody
    • MGC119962 antibody
    • MGC119963 antibody
    • MOS antibody
    • MOS_HUMAN antibody
    • MSV antibody
    • Oocyte maturation factor mos antibody
    • Proto oncogene serine / threonine protein kinase mos antibody
    • Proto-oncogene c-Mos antibody
    • Proto-oncogene serine/threonine-protein kinase mos antibody
    • v mos Moloney murine sarcoma viral oncogene homolog antibody
    see all

Images

  • Anti-MOS antibody (ab234990) at 1/500 dilution + Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa

  • Paraffin-embedded human testis tissue stained for MOS using ab234990 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab234990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up