Overview

  • Product name

  • Description

    Rabbit polyclonal to MOSC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human MOSC2 aa 202-298.
    Sequence:

    FQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEED TWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRL


    Database link: Q969Z3

  • Positive control

    • WB: RT4 and U-251 MG sp cell lysates. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 29,38 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalytic component of the benzamidoxime prodrug-converting complex, a complex required to reduce N-hydroxylated structures, such as benzamidoxime prodrug. Benzamidoxime is an amidine prodrug produced by N-hydroxylation which is used to enhance bioavailability and increase intestinal absorption. It is then reduced into benzamidine, its active amidine, by the benzamidoxime prodrug-converting complex.
  • Sequence similarities

    Contains 1 MOSC domain.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20605 antibody
    • MARC2 antibody
    • Mitochondrial amidoxime reducing component 2 antibody
    • mitochondrial antibody
    • Moco sulfurase C terminal domain containing protein 2 antibody
    • MOCO sulphurase C-terminal domain containing 2 antibody
    • Molybdenum cofactor sulfurase C terminal domain containing protein 2 antibody
    • MOSC domain containing protein 2 mitochondrial antibody
    • MOSC domain-containing protein 2 antibody
    • MOSC2 antibody
    • MOSC2_HUMAN antibody
    • RP11-270A6.1 antibody
    see all

Images

  • All lanes : Anti-MOSC2 antibody (ab224097) at 1/250 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 29,38 kDa

  • Paraffin-embedded human liver tissue stained for MOSC2 using ab224097 at 1/500 in immunohistochemical analysis.

References

ab224097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up