Overview

  • Product name

    Anti-Motilin receptor antibody
    See all Motilin receptor primary antibodies
  • Description

    Rabbit polyclonal to Motilin receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 348-397 (

    ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD

    ) of Human Motilin receptor (NP_001498).

  • Positive control

    • HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab133749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function

    Receptor for motilin.
  • Tissue specificity

    Expressed only in thyroid, stomach, and bone marrow.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • G-protein coupled receptor 38 antibody
    • GPR38 antibody
    • MLNR antibody
    • Motilin receptor antibody
    • MTLR antibody
    • MTLR_HUMAN antibody
    • MTLR1 antibody
    see all

Images

  • Anti-Motilin receptor antibody (ab133749) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size: 45 kDa

References

ab133749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up