Description

  • Product name

    Mouse BD-8 peptide
  • Expression system

    Synthetic
  • Accession

  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Mouse
    • Sequence

      DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK
    • Predicted molecular weight

      4 kDa
    • Amino acids

      27 to 60
    • Additional sequence information

      Modifications: Disulphide bridge Mature full length protein

Specifications

Our Abpromise guarantee covers the use of ab175152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as DEFB108B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol/L. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names

    • BD-8
    • beta 108
    • beta 108B
    • Beta-defensin 108B
    • Beta-defensin 8
    • D108B_HUMAN
    • DEFB-8
    • DEFB108
    • DEFB108B
    • DEFB8
    • Defensin
    • Defensin, beta 108B
    • hBD-8
    see all
  • Function

    Has antibacterial activity.
  • Tissue specificity

    Specifically expressed in testis. Low expression is detected also in liver.
  • Sequence similarities

    Belongs to the beta-defensin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab175152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up