For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    mouse-leptin-elisa-kit-ab100718.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones Hormones
Share by email

Mouse Leptin ELISA Kit (ab100718)

  • Datasheet
  • SDS
  • Protocol Booklet
Reviews (2)Q&A (4)References (22)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

ab100718 Leptin Mouse ELISA Kit
  • ab100718 Leptin Mouse ELISA Kit
  • Typical Standard Curve
  • Typical Standard Curve

Key features and details

  • Sensitivity: 4 pg/ml
  • Range: 4.1 pg/ml - 1000 pg/ml
  • Sample type: Cell culture supernatant, Plasma, Serum
  • Detection method: Colorimetric
  • Assay type: Sandwich (quantitative)
  • Reacts with: Mouse

You may also be interested in

ELISA
Product image
Human Insulin ELISA Kit (ab100578)
Primary
Product image
Anti-TAGLN/Transgelin antibody (ab10135)
ELISA
Product image
Mouse Adiponectin ELISA Kit (ab108785)

View more associated products

Overview

  • Product name

    Mouse Leptin ELISA Kit
    See all Leptin kits
  • Detection method

    Colorimetric
  • Sample type

    Cell culture supernatant, Serum, Plasma
  • Assay type

    Sandwich (quantitative)
  • Sensitivity

    < 4 pg/ml
  • Range

    4.1 pg/ml - 1000 pg/ml
  • Recovery

    94 %

    Sample specific recovery
    Sample type Average % Range
    Cell culture supernatant 94.47 83% - 103%
    Serum 93.29 82% - 102%
    Plasma 95.38 84% - 104%
  • Assay duration

    Multiple steps standard assay
  • Species reactivity

    Reacts with: Mouse
  • Product overview

    Mouse Leptin ELISA kit is designed for the quantitative measurement of Mouse Leptin in serum, plasma and cell culture supernatants.


    This assay employs an antibody specific for Mouse Leptin coated on a 96- well plate. Standards and samples are pipetted into the wells and Leptin present in a sample is bound to the wells by the immobilized antibody. The wells are washed and biotinylated anti-Mouse Leptin antibody is added. After washing away unbound biotinylated antibody, HRP-conjugated streptavidin is pipetted to the wells. The wells are again washed, a TMB substrate solution is added to the wells and color develops in proportion to the amount of Leptin bound. The Stop Solution changes the color from blue to yellow, and the intensity of the color is measured at 450 nm.

  • Platform

    Microplate

Properties

  • Storage instructions

    Store at -20°C. Please refer to protocols.
  • Components 1 x 96 tests
    120X HRP-Streptavidin Concentrate 1 x 200µl
    20X Wash Buffer 1 x 25ml
    5X Assay Diluent B 1 x 15ml
    Assay Diluent A 1 x 30ml
    Biotinylated anti-Mouse Leptin 2 vials
    Leptin Microplate (12 strips x 8 wells) 1 unit
    Recombinant Mouse Leptin Standard (lyophilized) 2 vials
    Stop Solution 1 x 8ml
    TMB One-Step Substrate Reagent 1 x 12ml
  • Research areas

    • Signal Transduction
    • Growth Factors/Hormones
    • Hormones
    • Neuroscience
    • Neurology process
    • Metabolism
    • Stem Cells
    • Mesenchymal Stem Cells
    • Adipogenesis
    • Cardiovascular
    • Atherosclerosis
    • Diabetes associated
    • Kits/ Lysates/ Other
    • Kits
    • ELISA Kits
    • ELISA Kits
    • Atherosclerotic proteins ELISA kits
    • Kits/ Lysates/ Other
    • Kits
    • ELISA Kits
    • ELISA Kits
    • Growth factors and hormones ELISA kits
    • Metabolism
    • Types of disease
    • Obesity
    • Metabolism
    • Types of disease
    • Heart disease
  • Function

    May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
  • Involvement in disease

    Defects in LEP may be a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities

    Belongs to the leptin family.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P41159 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Alternative names

    • FLJ94114
    • LEP
    • LEP_HUMAN
    • LEPD
    • Leptin
    • Leptin (murine obesity homolog)
    • Leptin (obesity homolog, mouse)
    • Leptin Murine Obesity Homolog
    • Leptin Precursor Obesity Factor
    • OB
    • Obese protein
    • Obese, mouse, homolog of
    • Obesity
    • Obesity factor
    • Obesity homolog mouse
    • Obesity Murine Homolog Leptin
    • OBS
    • OTTHUMP00000212285
    see all
  • Database links

    • Entrez Gene: 16846 Mouse
    • SwissProt: P41160 Mouse
    • SwissProt: P41160 Mouse
    • Unigene: 277072 Mouse

    Images

    • ab100718 Leptin Mouse ELISA Kit
      ab100718 Leptin Mouse ELISA Kit

      Ms Leptin measured in biological fluids showing quantity (pg) per mL of tested sample

    • ab100718 Leptin Mouse ELISA Kit
      ab100718 Leptin Mouse ELISA Kit

      Ms Leptin measured in cell lysates showing quantity (pg) per mg protein

    • Typical Standard Curve
      Typical Standard Curve

      Representative Standard Curve using ab100718

    • Typical Standard Curve
      Typical Standard Curve

      Representative Standard Curve using ab100718

    Protocols

    • Protocol Booklet

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (22)

    Publishing research using ab100718? Please let us know so that we can cite the reference in this datasheet.

    ab100718 has been referenced in 22 publications.

    • Tang Y  et al. Rapid responses of adipocytes to iron overload increase serum TG level by decreasing adiponectin. J Cell Physiol N/A:N/A (2021). PubMed: 33855731
    • Tournissac M  et al. Repurposing beta-3 adrenergic receptor agonists for Alzheimer's disease: beneficial effects in a mouse model. Alzheimers Res Ther 13:103 (2021). PubMed: 34020681
    • Lee K  et al. Dietary Silk Peptide Prevents High-Fat Diet-Induced Obesity and Promotes Adipose Browning by Activating AMP-Activated Protein Kinase in Mice. Nutrients 12:N/A (2020). PubMed: 31941008
    • Kim JH  et al. The Protective Effects of Acer okamotoanum and Isoquercitrin on Obesity and Amyloidosis in a Mouse Model. Nutrients 12:N/A (2020). PubMed: 32397362
    • Wei Z  et al. Disordered Leptin signaling in the retrotrapezoid nucleus is associated with the impaired hypercapnic ventilatory response in obesity. Life Sci 257:117994 (2020). PubMed: 32569780
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-6 of 6 Abreviews or Q&A

    Unable to detect leptin in plasma from young mice

    Poor Average 3/5 (Ease of Use)
    Abreviews
    Abreviews
    This ELISA was unable to detect physiological levels of leptin in preweaning mouse serum (age range postnatal days 5 to 14) despite very high leptin levels at this age. I repeated the same samples on a Leptin ELISA kit from Merck-Millipore and obtained results in the published range. I can provide more details confidentially if required.

    Abcam user community

    Verified customer

    Submitted Mar 17 2022

    CXCR1/2 Inhibitor Ladarixin Ameliorates the Insulin Resistance of 3T3-L1 Adipocytes by Inhibiting Inflammation and Improving Insulin Signaling

    Excellent Excellent 5/5 (Ease of Use)
    Abreviews
    Abreviews
    abreview image
    To evaluate the released leptin from mature adipocytes at the different conditions
    tested, a leptin mouse ELISA kit was performed in cell culture media. Briefly, the leptin
    standard curve was prepared and added to the plate as well as samples for 2.5 h at room
    temperature. After extensive washes, a biotinylated leptin detection antibody was added
    to each well and incubated for one hour. After other washes, the 1X HRP- Streptavidin
    solution was added to each well and incubated for 45 min at room temperature. After
    extensive washes, a one-step substrate reagent was added for 30 min, followed by a stop
    solution. The results were read immediately at 450 nm in a plate reader. Data were
    expressed as pg/mL.

    1. Controls cells (NG),
    2. High glucose cells (HG),
    3. NG plus inflammatory stimulus (NG-INF),
    4. HG plus inflammatory stimulus (HG-INF),
    5. NG plus KC (NG-KC),
    6. HG plus KC (HG-KC),
    7. NG-treated with ladarixin (NG-LAD),
    8. HG-treated with ladarixin (HG-LAD),
    9. NG-INF-treated with ladarixin (NG-INF-LAD),
    10. HG-INF-treated with ladarixin (HG-INF-LAD),
    11. NG plus KC with ladarixin (NG-KC-LAD),
    12. HG plus KC with ladarixin (HG-KC-LAD).

    PROF. Michele D'angelo

    Verified customer

    Submitted Oct 01 2021

    Question

    Protocol for cell lysate (lysis buffer and protocol recommendations)

    Read More

    Abcam community

    Verified customer

    Asked on May 29 2014

    Answer

    We have not yet tested ab100718 with cell lysates. However, the kit is compatible with many different samples types so lysates will most likely work. If you decide to test this kit with lysate samples, we recommend diluting the samples at least 5-fold with Assay Diluent B to minimize any effects of the detergents in the lysis buffer. The samples may need to be diluted further but this would need to be determined by you empirically. In brief, a lysis buffer must meet the following specifications: A) has relatively low salt content (700 mM or less) B) does not contain sodium azide C) does not contain >0.1% SDS D) does not contain >10 mM reducing agents (beta-mercaptoethanol or dithiothreitol).

    Read More

    Kevin Hanson

    Abcam Scientific Support

    Answered on May 29 2014

    Question

    I would like to measure Leptin in either plasma or serum of pigs. I would like to know the chances of one of the abcam available leptin ELISA kits to work in pigs. Find below the pig leptin aminoacid sequence
    MRCGPLCRFLWLWPYLSYVEAVPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGL
    DFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLP
    QARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
    Thank you

    Read More

    Abcam community

    Verified customer

    Asked on Apr 27 2012

    Answer

    Thank you very much for your inquiry and your interest in our kits.

    Unfortunately,the cross-reactivity of ab108879and ab108881 with pig samples is low, around 5%.

    For the other three kits, ab100581, ab100718 and ab100773,the laboratory has not tested these on pig samples and no prediction can be made, as not all epitopes are known.

    For the most part we do not see cross-species reactivity with sandwich based assays. If you would however nevertheless like to test on of these kits, please do let me know, as I would be able to provide you with an interesting testing offer.

    Please do also let me know whether you would like to discuss other options. Indeed, we have many individual antibodies against leptin in our catalog as well. Some of them are tested in pig (ab3583 and ab16227) and others are tested in ELISA. Again, we could discuss options and provide testing offers if you are interested in this.

    The testing offers would be along the line of the offer described here:
    https://www.abcam.com/collaborationdiscount

    I hope this information is helpful. I am looking forward to hear back from you.

    Read More

    Abcam Scientific Support

    Answered on Apr 27 2012

    Question

    What type of graph is required for the results from this kit, ab100718?

    Read More

    Abcam community

    Verified customer

    Asked on Mar 08 2012

    Answer

    Thank you for your enquiry.

    I have now received further information regarding the reading of the results from this kit. The manuals advise using a log-log model as this type of plot will fit most data sets very well. However, you can use any graphing model including linear regression, 4-parameter, 2-order polynomial, etc.When testing this kit, theoriginator ofthe kit plots theELISA data using log-log, linear regression, AND 4-parameter and then choose the model that fits the data best.

    I hope this is helpful to you. If you have any further questions, please do not hesitate to contact us.

    Read More

    Abcam Scientific Support

    Answered on Mar 08 2012

    Question

    Can this kit be used with blood samples? How much of my sample should I start with? Is there a suggested dilution/concentration?

    Read More

    Abcam community

    Verified customer

    Asked on Mar 31 2011

    Answer

    Thank you for your inquiry.  This kit ab100718 has been validated for serum, plasma, and cell culture supernatant samples. Are you using whole blood samples?  If so, this kit may work, but we would not recommend it as the chances of experiencing high background and interference would increase.  Below are some tips on sample preparation: How do I make preparation of blood and serum samples? For plasma: Collect blood into EDTA or Sodium heparin tube (e.g. BD vacutainer, Cat. No: 8001302 or 16852) Spin 10 minutes at 3000 rpm Aliquot into small tubes and store at –800C until use. For serum: Collect blood into tube without additive (e.g. BD vacutainer, Cat. No. 8002527) Keep at room temperature for 20 minutes Spin 10 minutes at 3000 rpm Aliquot into small tubes and store at –800C until use. Our recommended mouse serum/plasma sample dilution for ab100718 is ~10-40X.  Please note that this is just a recommendation and that the optimal dilution (if any) should be determined by the end-user empirically based on researched literature and knowledge of their particular samples.  Finally, 200ul of working volume per sample (100ul per well) is required if running each sample in duplicate (advised).  Additional information on the reagents and protocol can be found in the protocol booklet. https://www.abcam.com/ps/products/100/ab100718/documents/Leptin-Mouse-ELISA-Kit-ab100718-protocol-plain.pdf I hope this information helps. Please contact us with any other questions.

    Read More

    Abcam Scientific Support

    Answered on Mar 31 2011

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.