Overview

  • Product name

  • Description

    Rabbit polyclonal to MPP2/DLG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse MPP2/DLG2 aa 3-214. (Expressed in E.coli).
    Sequence:

    VAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIVRSLAKAH ERLEETKLEAVRDNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQS LLETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLG VTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQE LLRSASGSVILK


    Database link: Q9WV34

  • Positive control

    • WB: Mouse cerebrum and kidney lysates; Recombinant mouse MPP2/DLG2 protein. IHC-P: Mouse esophagus tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231634 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 62 kDa.

Target

  • Relevance

    MPP2/DLG2 (Palmitoylated membrane protein 2) is a member of a family of membrane associated proteins termed MAGUKs (membrane associated guanylate kinase homologs). These proteins interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP2/DLG2 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction.
  • Cellular localization

    Cell Membrane; integral membrane protein
  • Database links

  • Alternative names

    • D11BWG0652E antibody
    • Discs Large Homolog 2 antibody
    • DLG2 antibody
    • DLGH2 antibody
    • Homolog of DLG A tumor supressor antibody
    • MAGUK p55 Subfamily Member 2 antibody
    • Membrane Protein Palmitoylated 2 antibody
    • MPP2_HUMAN antibody
    • PALS4 antibody
    see all

Images

  • A4549 (Human lung carcinoma cell line) cells stained for MPP2/DLG2 using ab231634 at 20 µg/ml in ICC/IF.

  • Formalin-fixed, paraffin-embedded mouse esophagus tissue stained for MPP2/DLG2 using ab231634 at 10 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse esophagus tissue stained for MPP2/DLG2 using ab231634 at 10 µg/ml in immunohistochemical analysis.

  • Anti-MPP2/DLG2 antibody (ab231634) at 2 µg/ml + Mouse kidney lysate

    Predicted band size: 62 kDa

  • Anti-MPP2/DLG2 antibody (ab231634) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 62 kDa

  • Anti-MPP2/DLG2 antibody (ab231634) at 2 µg/ml + Recombinant mouse MPP2/DLG2 protein

    Predicted band size: 62 kDa

References

ab231634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up