Anti-MPP3/DLG3 antibody (ab254633)
Key features and details
- Rabbit polyclonal to MPP3/DLG3
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MPP3/DLG3 antibody
See all MPP3/DLG3 primary antibodies -
Description
Rabbit polyclonal to MPP3/DLG3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MPP3/DLG3 aa 478-569.
Sequence:VCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPF DEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVL
Database link: Q13368 -
Positive control
- IHC-P: duodenum tissue. ICC/IF: U-2 OS cells. WB: MPP3/DLG3 overexpressed HEK-293T whole cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab254633 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 14 kDa. | |
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the MAGUK family.
Contains 1 guanylate kinase-like domain.
Contains 2 L27 domains.
Contains 1 PDZ (DHR) domain.
Contains 1 SH3 domain. - Information by UniProt
-
Database links
- Entrez Gene: 4356 Human
- Omim: 601114 Human
- SwissProt: Q13368 Human
- Unigene: 396566 Human
-
Alternative names
- Discs large (Drosophila) homolog 3 antibody
- Discs large homolog 3 antibody
- DLG 3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MPP3/DLG3 antibody (ab254633)Paraffin-embedded human duodenum tissue stained for MPP3/DLG3 using ab254633 at 1/200 dilution in immunohistochemical analysis.
-
Lane 2 : Anti-MPP3/DLG3 antibody (ab254633) at 0.4 µg/ml
Lane 1 : DNA Ladder
Lane 2 : MPP3/DLG3 overexpressed HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Predicted band size: 14 kDa -
PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling MPP3/DLG3 using ab254633 at 4µg/ml (green) in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab254633 has not yet been referenced specifically in any publications.