Anti-MPP3/DLG3 antibody (ab254633)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MPP3/DLG3 antibody
See all MPP3/DLG3 primary antibodies -
Description
Rabbit polyclonal to MPP3/DLG3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MPP3/DLG3 aa 478-569.
Sequence:VCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPF DEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVL
Database link: Q13368 -
Positive control
- IHC-P: duodenum tissue. ICC/IF: U-2 OS cells. WB: MPP3/DLG3 overexpressed HEK-293T whole cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab254633 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 14 kDa. | |
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the MAGUK family.
Contains 1 guanylate kinase-like domain.
Contains 2 L27 domains.
Contains 1 PDZ (DHR) domain.
Contains 1 SH3 domain. - Information by UniProt
-
Database links
- Entrez Gene: 4356 Human
- Omim: 601114 Human
- SwissProt: Q13368 Human
- Unigene: 396566 Human
-
Alternative names
- Discs large (Drosophila) homolog 3 antibody
- Discs large homolog 3 antibody
- DLG 3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MPP3/DLG3 antibody (ab254633)Paraffin-embedded human duodenum tissue stained for MPP3/DLG3 using ab254633 at 1/200 dilution in immunohistochemical analysis. -
Western blot - Anti-MPP3/DLG3 antibody (ab254633)Lane 2 : Anti-MPP3/DLG3 antibody (ab254633) at 0.4 µg/ml
Lane 1 : DNA Ladder
Lane 2 : MPP3/DLG3 overexpressed HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Predicted band size: 14 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-MPP3/DLG3 antibody (ab254633)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling MPP3/DLG3 using ab254633 at 4µg/ml (green) in ICC/IF.
Datasheets and documents
References
ab254633 has not yet been referenced specifically in any publications.
