Overview

  • Product name

  • Description

    Rabbit polyclonal to MPPB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MPPB aa 395-488.
    Sequence:

    SEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDA VNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR


    Database link: O75439

  • Positive control

    • ICC/IF: SK-MEL-30 cells.
  • General notes

    Previously labelled as PMPCB. 

Properties

Applications

Our Abpromise guarantee covers the use of ab221986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Cleaves presequences (transit peptides) from mitochondrial protein precursors.
  • Sequence similarities

    Belongs to the peptidase M16 family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta MPP antibody
    • Beta-MPP antibody
    • BetaMPP antibody
    • Mitochondrial processing peptidase subunit beta antibody
    • Mitochondrial-processing peptidase subunit beta antibody
    • MPP11 antibody
    • MPPB antibody
    • MPPB_HUMAN antibody
    • MPPP52 antibody
    • P 52 antibody
    • P-52 antibody
    • P52 antibody
    • Peptidase mitichondrial processing beta antibody
    • PMPCB antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells stained for MPPB (green) using ab221986 at 4 µg/ml in ICC/IF.

References

ab221986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up