Overview

  • Product name

    Anti-MPT64 antibody (HRP)
    See all MPT64 primary antibodies
  • Description

    Rabbit polyclonal to MPT64 (HRP)
  • Host species

    Rabbit
  • Conjugation

    HRP
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to MPT64 aa 24-228. Mature form of Mycobacterium tuberculosis MPT64.
    Sequence:

    APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQT RDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGT HPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQ VSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAI DSMLA


    Database link: P9WIN8

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 25 kDa.

Target

  • Cellular localization

    Secreted
  • Alternative names

    • Antigen MPT64 antibody
    • immunogenic protein antibody
    • immunogenic protein Mpt64 antibody
    • mpb64 antibody
    • MT2032 antibody
    • MTCY39.39 antibody
    • Rv1980c antibody
    • simliar to Rv1980c of M. tuberculosis H37Rv antibody
    see all

References

ab193387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up