Overview

  • Product name

  • Description

    Rabbit polyclonal to MPZL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MPZL aa 195-269.
    Sequence:

    NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQL DHSGGHHSDKINKSESVVYADIRKN


    Database link: O95297

  • Positive control

    • HaCaT cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    Cell surface receptor, which is involved in signal transduction processes. Is a major receptor for concanavalin A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine protein kinases. Isoform 3 seems to block tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, unlike isoforms 2 and 3, may be involved in regulation of integrin mediated cell motility.
  • Cellular localization

    Membrane; single pass type I membrane protein (Potential)
  • Database links

  • Alternative names

    • immunoglobulin family transmembrane protein antibody
    • MPZL1 antibody
    • MPZL1b antibody
    • myelin protein zero like 1 antibody
    • Myelin protein zero like protein 1 antibody
    • myelin protein zero like protein 1 precursor antibody
    • myelin protein zero like protein MPZL1b antibody
    • OTTHUMP00000032519 antibody
    • protein zero related antibody
    • PZR antibody
    • PZR1b antibody
    • PZRa antibody
    • PZRb antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HaCaT cells labeling MPZL with ab221364 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up