Overview

  • Product name

  • Description

    Rabbit polyclonal to MR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MR1 aa 149-226.
    Sequence:

    LSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTL QRTEPPLVRVNRKETFPGVTALFCKAHG


    Database link: Q95460

  • Positive control

    • ICC/IF: HaCaT (human keratinocyte cell line) cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Antigen-presenting molecule specialized in presenting microbial vitamin B metabolites. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T-cells (MAIT). MAIT lymphocytes are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand-dependent.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Domain

    The alpha-3 region and to a lesser extent the transmembrane and cytosolic domains regulate surface expression. The alpha-3 region mediates interaction with B2M (PubMed:23051753).
    The ligand-binding groove is ideally suited to present small organic compounds that can originate from vitamins rather than antigenic peptides.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted; Cell membrane. Endoplasmic reticulum and Cell membrane. Endoplasmic reticulum membrane. The larger proportion remains in the ER in an immature state. The subset that reach cell surface does it through a B2M-independent pathway.
  • Information by UniProt
  • Database links

  • Alternative names

    • Class I histocompatibility antigen like protein antibody
    • Class I histocompatibility antigen-like protein antibody
    • HLALS antibody
    • HMR1_HUMAN antibody
    • Major histocompatibility complex class I like sequence antibody
    • Major histocompatibility complex class I related antibody
    • Major histocompatibility complex class I related gene protein antibody
    • Major histocompatibility complex class I related isoform CRA a antibody
    • Major histocompatibility complex class I related isoform CRA c antibody
    • Major histocompatibility complex class I related isoform CRA d antibody
    • Major histocompatibility complex class I-related gene protein antibody
    • MHC class I like antigen MR 1 antibody
    • MHC class I like antigen MR1 antibody
    • MHC class I related gene protein antibody
    • MHC class I related protein 1 isoform B antibody
    • MHC class I related protein 1 isoform C antibody
    • MHC class I-related gene protein antibody
    • MR 1 antibody
    • Mr1 antibody
    • Mr1 protein antibody
    • MR1B antibody
    • MR1C antibody
    see all

Images

  • PFA fixed/ Triton X-100 permeabilized HaCaT (human keratinocyte cell line) cells stained for MR1 (green) using ab222143 (4 µg/ml) in Immunocytochemistry/ Immunofluorescence.

References

ab222143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up