Overview

  • Product name

  • Description

    Rabbit polyclonal to MRAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human MRAP2 aa 66-205.
    Sequence:

    LLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSL FHCYINEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFD IPNFVNTDQNYFGEDDLLISEPPIVLETKPLSQTSHKDLD


    Database link: Q96G30

  • Positive control

    • WB: Mouse brain and kidney tissue lysates. ICC/IF: U-251 MG cells. IHC-P: Human lung and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab237537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 24 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-MRAP2 antibody (ab237537) at 1/1000 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 24 kDa

  • U-251 MG (human brain glioma cell line) cells stained for MRAP2 (green) using ab237537 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human lung tissue stained for MRAP2 with ab237537 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for MRAP2 with ab237537 at 1/100 dilution in immunohistochemical analysis.

References

ab237537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up