Anti-MRas antibody (ab230245)
Key features and details
- Rabbit polyclonal to MRas
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-MRas antibody
See all MRas primary antibodies -
Description
Rabbit polyclonal to MRas -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat
-
Immunogen
Recombinant fragment corresponding to Human MRas aa 79-208.
Sequence:EQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKV DLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQ IPEKSQKKKKKTKWRGDRATGTHKLQCVIL
Database link: O14807-1 -
Positive control
- WB: Mouse brain tissue lysate. IHC-P: Human testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab230245 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/1000 - 1/5000. Predicted molecular weight: 24 kDa. |
Target
-
Function
May serve as an important signal transducer for a novel upstream stimuli in controlling cell proliferation. Weakly activates the MAP kinase pathway. -
Tissue specificity
Expression highly restricted to the brain and heart. -
Sequence similarities
Belongs to the small GTPase superfamily. Ras family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 22808 Human
- Entrez Gene: 17532 Mouse
- Entrez Gene: 25482 Rat
- Omim: 608435 Human
- SwissProt: O14807 Human
- SwissProt: O08989 Mouse
- SwissProt: P97538 Rat
- Unigene: 527021 Human
see all -
Alternative names
- FLJ42964 antibody
- M ras antibody
- M-ras antibody
see all
Images
-
Western blot - Anti-MRas antibody (ab230245)Anti-MRas antibody (ab230245) at 1/1000 dilution + Mouse brain tissue lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 24 kDa
Observed band size: 24 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRas antibody (ab230245)Paraffin-embedded human testis tissue stained for MRas using ab230245 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230245 has not yet been referenced specifically in any publications.
